SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018547 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018547
Domain Number 1 Region: 21-123
Classification Level Classification E-value
Superfamily Immunoglobulin 2.8e-17
Family V set domains (antibody variable domain-like) 0.0066
Further Details:      
 
Domain Number 2 Region: 138-224
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000559
Family I set domains 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000018547
Domain Number - Region: 230-261
Classification Level Classification E-value
Superfamily Gated mechanosensitive channel 0.0353
Family Gated mechanosensitive channel 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018547   Gene: ENSGMOG00000017259   Transcript: ENSGMOT00000019002
Sequence length 271
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4280:80529:85988:1 gene:ENSGMOG00000017259 transcript:ENSGMOT00000019002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TWPSLTLAVLLSVTGCAELITVTSPQRYVNVTVGGSLLLQCSFQPTKETTNLVVMWNFVE
KSSSSLKQIYYSQADQDVVPPEYKGRLSLPPSHGTGGNVSIGISNMQTADSGLYTCEVRN
SPDIGGKTEASIVXXXXXPPSAPFCAVHGDVAVGHLVTLTCHSEKGSPPPTYTWVRLDQA
RARQPIMARVTPTGILEIRNISEFKFGEYQCTSTNAVGTSTCMVEAEDGVIAGAVIGALL
GCLLIALVVWFIAHQVKKHRYAAVKTPAAEM
Download sequence
Identical sequences ENSGMOP00000018547 ENSGMOP00000018547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]