SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018657 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018657
Domain Number 1 Region: 88-291
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.3e-56
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 274-418
Classification Level Classification E-value
Superfamily PH domain-like 1.9e-32
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 
Domain Number 3 Region: 546-642
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000014
Family Pleckstrin-homology domain (PH domain) 0.00056
Further Details:      
 
Domain Number 4 Region: 386-426,464-516
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000163
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018657   Gene: ENSGMOG00000017340   Transcript: ENSGMOT00000019114
Sequence length 669
Comment pep:novel genescaffold:gadMor1:GeneScaffold_747:344010:361387:1 gene:ENSGMOG00000017340 transcript:ENSGMOT00000019114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSSERHGKVPNRDSGIDSPSCTVEGEVFPNEDAIDEEDRYDSVTETETSVSCCVTLGNKR
DSTQDEDSDLDEGSCGEAEGGTDALSEAQRLLNIARELLHTEEAYVKRLNLLDQVFCTKL
TEAAIPQDVITGIFSNISSIYCFHHKFLLPELKTRIIGEWESNPRIGDILQKLAPFMKMY
GEYVKNFDRAMDLVNTWTQRSSLFKSVVQNIQQQAVCGNLTLQHHMLEPVQRIPRYELLL
KDYLKKLADDAADRKDTEKALELISTAANHSNAAIRKMEKMHKLLEVYERLGGEEDIVNP
ANELIKEGHIKKMSAKNGTAQDRYLYLFNNMVLYCVPKLRLMGQKFSVRERIDIAGMEVQ
EIVKQNLPHTFAIIGKQRSLELQARTAEEKEDWIQVILATIERHKQNSETFNKAYNSSFS
REDDHQPDSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSRKKDKEKQTCKGCNESFNF
TKRKHHCKSCGAAICAKCSKSLDNKTSRVCPECFDASVSLEVLGVGDQKRKAATERQTSL
TGENCLLCGYLQLQDKGKSWSKMWAGVAKAESLVLYLQSSGQDMKGARAVPLPGFEVTVV
SPPLSDKSDAKHAFRLTHGPQTLVFAAHDGELLAKWVELLTISFLKRTTSSPSFSLSLYL
SIPPLSLSS
Download sequence
Identical sequences ENSGMOP00000018657 ENSGMOP00000018657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]