SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018753 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018753
Domain Number 1 Region: 173-270
Classification Level Classification E-value
Superfamily AMPKBI-like 5.76e-35
Family AMPKBI-like 0.00001
Further Details:      
 
Domain Number 2 Region: 77-161
Classification Level Classification E-value
Superfamily E set domains 9.1e-26
Family AMPK-beta glycogen binding domain-like 0.0000771
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018753   Gene: ENSGMOG00000017381   Transcript: ENSGMOT00000019211
Sequence length 270
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2106:22940:25010:-1 gene:ENSGMOG00000017381 transcript:ENSGMOT00000019211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSNSDRGSGAQGERSDRDGQPGGKEARSNILMDSTDDADIVNINTHSPSAPQEIQEFL
AWQRDLESNTKNPAQSRPTVFTWKGGAKEVFVSGSFNNWANKIPLNKSHSNFVAIVDLPE
GEHQYKFCVDGNWTLDPTGAVTTTKTGTINNTIEVKRTDFEVFDALRIDSEETADISDLS
SSPPGPYLQDAYLFKPEDKIKHPPILPPHLLQVLLNKDTGISCDPTLLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
Download sequence
Identical sequences ENSGMOP00000018753 ENSGMOP00000018753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]