SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018781 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018781
Domain Number 1 Region: 16-69
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000166
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Domain Number 2 Region: 180-250
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000013
Family V set domains (antibody variable domain-like) 0.07
Further Details:      
 
Domain Number 3 Region: 420-658
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.00000000327
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.049
Further Details:      
 
Domain Number 4 Region: 313-353
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000513
Family I set domains 0.03
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000018781
Domain Number - Region: 137-176
Classification Level Classification E-value
Superfamily EF-hand 0.000208
Family Eps15 homology domain (EH domain) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018781   Gene: ENSGMOG00000017464   Transcript: ENSGMOT00000019239
Sequence length 755
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4412:64904:171435:-1 gene:ENSGMOG00000017464 transcript:ENSGMOT00000019239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRRTYCGRGRQCLVLAETGRAECVCQEKCRPSFVPVCGSDGRFYENHCEVYRTACLEKRR
IYVVHSKDCFFKGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXCVQISMKEHLEDSLLECSMQDLLRYDDYNNDGHLTLHEFYTAFQVVQLSLPEEQRIS
VSTVTVGLSMVLSCAIQGTLRPPIIWKRNGIILNFLDLEDINDFGDDGSLYITKVTTIHM
GKYSCHAYGYEDLHQTHVLQVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXSFVCLSANGSELYIGSVRYEDTGAYTCIAKNEVGVDEDISSLFVEDSAR
KTLANILWREEGICHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEMCPKGEGVAPQR
CAWSSAVNVREKYIYVSQPLQSRLLVVDTQAQKVVQAVATDPYPVKLLYDKSHDQIWVLT
WGDMQKTYPTLQVIPQASVGEVHKAIRTTFQRVSDFFIPPTNLIITHVRFAFLFLKNEPA
VHKIDLETLHRVKTISLKNYSCMPVSMAYTHLSGFYFVQCQSQLLLDSVTDTVIGPNRNI
TGRPYVSPDGRYIVTPDPRSSRLVVQTVSFTGELAVSQELDSPAGVSDVVFQPSFTESNQ
YSLAAASGSGTDLLFSHLWSEGHSKVLRGLKEPVRPQAWPWGGPNRPLVASGLFGQYLLT
PSTESLFVLDGKQSSPHCEVSDIKRGNTMSGSGSM
Download sequence
Identical sequences ENSGMOP00000018781 ENSGMOP00000018781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]