SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018852 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018852
Domain Number 1 Region: 121-218
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-28
Family Pleckstrin-homology domain (PH domain) 0.0048
Further Details:      
 
Domain Number 2 Region: 704-772,831-867
Classification Level Classification E-value
Superfamily Second domain of FERM 5.1e-18
Family Second domain of FERM 0.0075
Further Details:      
 
Domain Number 3 Region: 302-408
Classification Level Classification E-value
Superfamily PH domain-like 1.52e-17
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 4 Region: 239-293
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000126
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 5 Region: 29-122
Classification Level Classification E-value
Superfamily PH domain-like 0.00000241
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000018852
Domain Number - Region: 871-957
Classification Level Classification E-value
Superfamily PH domain-like 0.027
Family Third domain of FERM 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018852   Gene: ENSGMOG00000017524   Transcript: ENSGMOT00000019311
Sequence length 975
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3665:372:194385:-1 gene:ENSGMOG00000017524 transcript:ENSGMOT00000019311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DYDQDDYDQDALGSSAGRPGSHPRSGQWSPDYQGSLGTYSSSAAYRFSSEGPSLLEDSEE
DFDRFETDEELSYRRDSVYSCVTLPYFHSFLFIKAGGLMNTWRRRWCVLKDETFLWFRAK
QEALKQGWLLKKGGGSSTLSRRNWKRRWFVLRQSKLMYFENDGEDKMKGMLDMHAAKEVV
DNTGKENGLDIVMADRTYHLIAETAEDASQWFSVLSQVQGSTEQEIREMHDEQANPQNAV
GTLDVGMIDSVCASDNPERSNSFVMITANRVLQCQADTPEEMHHWITLLQRCKGDTRVHG
QEFIIRGWLQKELKNSSRAALKLKKRWFLLTHNSLDYYKSSERQALKLGTLVLNSLCSVV
QPDDKVFKETGYWNVTVFGRRHSYRLYTKLLTEASRWAGAIQTVIDSKAPIDTPTQQLIH
DIKENCLNSEVVEQIYKRNPILRHSHHPLHSPLLPLPYGDIHLSSLRTKGPTTLQDEALK
VFASLQHLEGVADPLPVIQGVLRTGQELRPLRDELYCQLVKQTALPPHPGGPGNLCSWRI
LACMACTFLPSRGVLRYLKFHLKRTKELSPNSEMERYASFALDSLKKTRTREHVPAQEEI
RAIVARQEMTTMVHCHGGGSCKITINSHTTAGEVVKKLTWGLAMEGSRNMFALFEHNDSV
DKAIEXXXXXXXXXXXXXXLSAGQDPQATGWRFYFKLYCFLDTDGVPRDSVEFAFMFEQA
HEAVIRGRYPAPEETLQFLAALRLQYLLGDHGSPAPLPDMAQVFPVARLRARVQNSAKTF
APGAGSVSERPGAERKRSSFLEGTLRRSFRSGSLSRQKLLEEENSLEAWLREETAAVHAS
VLDKWRRLVGMNQEQAMGKYMALVKEWAGYGSTLFNVESTDEAFPSELWLGVSRQAVSLY
KRGEPWPLEVFPYEQILSFGAPLPNAYKIAVEGRELLFETPLVMDIAKLMKAYISMMVMK
RHSNPQSLSSHGSQS
Download sequence
Identical sequences ENSGMOP00000018852 ENSGMOP00000018852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]