SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018876 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018876
Domain Number 1 Region: 866-1058
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.47e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00059
Further Details:      
 
Domain Number 2 Region: 35-70
Classification Level Classification E-value
Superfamily WW domain 0.000000043
Family WW domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018876   Gene: ENSGMOG00000017547   Transcript: ENSGMOT00000019335
Sequence length 1063
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2467:603256:627752:1 gene:ENSGMOG00000017547 transcript:ENSGMOT00000019335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSDWVEILEPRSRERMYVNLASGECGWEPPLGAPVRQADGNQWWELFDPQSGRFYYYNSV
GRRTVWHRPQGGDIVPLSQLQAMKRSKEAAESRSQGDGSSSTEYSADGKEPLRDTPQRWQ
PPPGSKAAMLVKVNSMSRSQASPSVQPNAQPSTHISKASAFTLHPAGSKSPGGHLATAQG
YKTTPSGKMTSDPRQAHHLRKGSNGSFCLVMTEGGHPSPLLLRSQSSTPRPASPPYGSTA
PLYDDPVTECPIYDEPPMDMEVEGAHLHNNPSLPRLTPTHSLQKTRLLQHPGPPHMGARH
KRNPSESDYSPAGLECIKHMVNVDPKQGTLSQVSPGSTRSPSPTSRPDPPPXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMREVRAGLDPEL
GERVGVVIPRTLSPVDGARWYGGGGSAGRGSSREDLTGAALARSKGRAGHQSNPALSPLE
LPGRQKRTYEKVDTLEKSITSQASLSSPETPGPASQTGTLELQGQLESRKKGMVDGRTAS
LGPHRPAHDNREAGDGGEGRPGGSTYTLSYASLRQPPPPDMGMEDWASKHLNMHTQGLFR
RRVSIANMLSWNRGSIKKPMLVTSNRAVRKEACEMFKLVQAYMGDRPSRLGRRHCALLIV
TKCWDLPGLRDELYVQLVRQTTGNTSPRSLAAGWELMAVSLAFFAPSPKFRCYLEGYIQR
HTEPSSDKKLTQFILEQQELKLKKNSKSRKKRKQNSEDEEGLPISTYAKFCYRKLQKVAI
TGGKKGLRKPTLEEIDHSRRAIVTPSLFGSSLEEVMERQSELFPDRKLPWVQVQLSQYVL
ALGGAQTEGIFRVPGDIDEVNALKLQVDQWRIPENLSDPNVPSSLMKLWYRELEEPLIPM
NFYKQCVSNYDDPMAAIDVVQSLPELNRLVLCYFIHFLQVFAQPANVSVTKMDVNNLAMV
MAPNCLRCQSDDPRIIFENTRKEMSFLRMLIVHLDTSFIEGVV
Download sequence
Identical sequences ENSGMOP00000018876 ENSGMOP00000018876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]