SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018890 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018890
Domain Number 1 Region: 401-537
Classification Level Classification E-value
Superfamily TIMP-like 7.65e-30
Family Netrin-like domain (NTR/C345C module) 0.022
Further Details:      
 
Domain Number 2 Region: 179-273
Classification Level Classification E-value
Superfamily Immunoglobulin 9.2e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 354-410
Classification Level Classification E-value
Superfamily BPTI-like 5.11e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0034
Further Details:      
 
Domain Number 4 Region: 292-349
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000497
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.016
Further Details:      
 
Domain Number 5 Region: 93-143
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000929
Family Ovomucoid domain III-like 0.028
Further Details:      
 
Domain Number 6 Region: 6-58
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000366
Family Elafin-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018890   Gene: ENSGMOG00000017571   Transcript: ENSGMOT00000019349
Sequence length 545
Comment pep:novel scaffold:gadMor1:scaffold07844:62212:65159:1 gene:ENSGMOG00000017571 transcript:ENSGMOT00000019349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMSLAKVVYSHAGMCPNELNPNLWVDAMSTCMRECESDQDCETFEKCCANVCGNKSCVA
ARYLDIKGHRGPIGMPTGATCDKLMCSQQGSECDIWDGQPVCKCRDRCEREPLFTCASDG
MTYYNKCYMDAEACSHGTSISVVTCRFHLTWPNTSPVPMETTLRPTTALQTTLPADAQPA
LLSGPAQLAVLVGDTASFLCEVAGKPRPELTWEKQLEGSENAVMRPNHVRGNVVVTNIGQ
LVIYNAQPHDAGVYTCTARNAAGSVSAHFPLAVVRREEGGGPGAEGNGSGRPFPAEECLK
GPDTDDCGEESISWYYESMRNNCFTFTYSQCNKNRNHFASHQACMRSCGVELAAPCGLPS
LQGPCKAYEPRWAYSAALKQCQSFVYGGCGGNENNFESKGACEEMCPYPKNRHCKACRPR
GKMVTSFCRSDFVVLGRMTELTEEQESGHALVTVEEILKDDKMGLKFFGKEPLEVTLLSM
DWKCPCPNVTAAPGQLILMGEVTAGMAVLQPDSFVAASSARRVRKLREVVQKKTCDFLKE
FTTIQ
Download sequence
Identical sequences ENSGMOP00000018890 ENSGMOP00000018890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]