SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018893 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018893
Domain Number 1 Region: 151-262,303-574
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.31e-148
Family Myotubularin-like phosphatases 0.0000000307
Further Details:      
 
Domain Number 2 Region: 1070-1136
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.25e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0017
Further Details:      
 
Domain Number 3 Region: 51-132
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000197
Family GRAM domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018893   Gene: ENSGMOG00000017536   Transcript: ENSGMOT00000019352
Sequence length 1151
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2106:142893:167787:1 gene:ENSGMOG00000017536 transcript:ENSGMOT00000019352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEEEGQQSLECVQANQFFPKKSPVLEEENMQVPFSQLHGEFTEYVGRAEDAIIAMSNYRL
HIKFKESVVNVPLQLIENVECRDIFQLHVTCKDCKVVRCQFSTLEQCQEWLKRLSAAGRP
PSSLEHLFSFAFHAWCMDVYAGEKEQHGELCRPGEHVTSWFKNEVERMGFDTQNAWRISD
INSRFRLCSSYPQQLLVPAWITDKELENVAAFRSWKRFPAVVYRHVTTGAVIARCGQPEV
SWWGWRNADDEHLVQSIAKACAVDGISRKHQANGGYSNGTALPDTDFESSLTNNSEVETL
AIQPHKLLILDARSYAAAVANRAKGGGCECPEYYPNCEVVFMGMANIHSIRKSFQSLRFL
CTQMPDPANWLSALESTKWLQHLSLLLKAALLAVNAVHRDHRPVMVHCSDGWDRTPQIVA
LSKMLLDPYYRTIEGFQVLVETDWLDFGHKFADRCGHGENSEDVNERCPVFLQWLDCVHQ
LQRQFPCSFEFNEAFLVKLVQHAYSCLFGTFLCNSGKEREDRHVQERTCSVWSLLRSGNR
ALCNMLYSSQSETVLHPVCHVRNLMLWTAVYLPSSSPTTPSDDSCAHYPAPGSSPEEATL
GRRPKTRSFDNLPSACELGSMAAPNRRSSDPSLNEKWQDHRRSLELSCVTAGPDGGAGGP
EDLEDQTDGGAEEAELSVAPGVAEGQMENILREATKEEAAAAVAAAVHRERGVAQVVSNG
DTDMGKGIGSVESDEKRAEVDGGTENQSEPLCNGHLGASAAEGGAPPLPASTSEETERMQ
QSLEADVGRILEELVKQEPEDAASHRTHTNGCLVGRSRGSAVTVATPQAPGAGKTASLME
SSTETLTDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXG
SPEQQSRLHLDDDGLTLHPDAIQQRLRQMEACHQKEVESLKRQMQELRTRLENQQHGGCP
RLNGDQGDEGTSIMDSEYNMDPNCLSRCSTELLSEASWEQVDKTDAEVTRWYPDHLAAQC
YRCESRFWLASRKHHCRNCGNVFCASCCDQKIPVPSQQLFEPSRVCKSCYGNLTPCPGPL
DVEQPITVSSD
Download sequence
Identical sequences ENSGMOP00000018893 ENSGMOP00000018893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]