SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018909 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018909
Domain Number 1 Region: 5-473
Classification Level Classification E-value
Superfamily Sema domain 4.58e-161
Family Sema domain 0.00000000181
Further Details:      
 
Domain Number 2 Region: 474-526
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000497
Family Plexin repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018909   Gene: ENSGMOG00000017568   Transcript: ENSGMOT00000019368
Sequence length 798
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3816:824366:840176:1 gene:ENSGMOG00000017568 transcript:ENSGMOT00000019368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKERSAKRFSVDGVSNYTSLLLSKEDDMLYVGAREALFALSLSDISKDKLQKNMTWGTPV
GKREECSFKGKNLETDCFNYIKILLRLNSTHLYVCGTYAFSPICAYINTSTFSLERDDSG
EVLMEDGRSRCPFNPEYKSTAIIVDGELYAGTVSNFQGNEPVIYKSLGHGTALKTENSLN
WLQDPVFVGSAYIEESQPTGNPVGDDDKIYFFFSEAGKEFDFFDNTIVSRIARVCKGDKG
GERVLQKKWTTFLKAQLLCSLPDDGFPFNIIQDMFVLKPMGDGWENTVFYGVFTSQWYKG
ASGSSAVCAFTMAQVERAFSGRYREVNRESQQWYTYNHPLPEPRPGACVTSRARQAGIQS
SLHMPDKVLNFVKDHFLMDSVIRSPPLLLKRNVRYTQIAVHKIQGMERAYDVLFIGTDDG
KLHKAINTNDRMHIIEEMTLFATPQPVQHIELDPQRGLLFVSSYSGLVEVPVANCTNYAS
CGECVLSRDPYCAWTGRLCPAVDPVSLSRRSHWQQDVEEADTSAICNKTSHSPGFKAPAS
RVSACQLMTIPMNTFRVLPCVLRSNLATRRWHYSASAKEFLYATPEGHLVVVAQPDRTET
YECWSEEEGFRQLLANYCVRAEPRQESTTLVGHSRTPHVEREESILILPGESRSTQFHAK
TYWNELIVVCALLAFSLLVFSLFVAYRNRDRMKSMLKQGECPNMQQKKPRIVGKPTESLP
LNGSAIPVSTSDHKGYQTLNDNYICSTPTHESSPDNSKSFSEASDRRPLNVKESHVEYSP
TCPRPRVRLGSEIKDSIV
Download sequence
Identical sequences ENSGMOP00000018909 ENSGMOP00000018909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]