SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018915 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018915
Domain Number 1 Region: 198-265
Classification Level Classification E-value
Superfamily EF-hand 0.00000175
Family Calmodulin-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018915   Gene: ENSGMOG00000017546   Transcript: ENSGMOT00000019374
Sequence length 501
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4646:59186:68748:-1 gene:ENSGMOG00000017546 transcript:ENSGMOT00000019374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQEEEEEGGDFGGSGDASSPYVPPYRPTLPARERLHIQKSNVCSRAYFVVVMVFFHVYIL
NVIALLLYVHYNNGPGDLASVDGSPTETVAEDGSPLPHAAPPDQVLEMNKYRQSYSLPRI
EGIRVGHVQRVSLMPEKTHEMKTLSLKPLLFEIPGFLSEEECRVVVQLAQLKGLTESQTT
ASSGGEQQEPGQPLLVLTTDEVFSLLDLDQDGLLQKQEIVSHSRSQDGTWLSPDNLRQIL
TGLEAQQAGALTLEDFRLVFDIFKHPAKQRSSTLQGHFQRRSKHTRMYQGPGSHHVLHSL
RNRVTRLARLPSPLVEFSEPLQVIRYEQGGFSNAHHDSSPAHSETTCAHTRLAGNTSTLT
EIKCRYLTVMVYLNSVVEGGETTFPVADNRTYEQEVGNTDTRATCERGNLRVKPTAGTAL
LWYNHLSDGRGWMGEVDEYSLHGGCPVMLGEKWVANSWVNVDPDHQRQARYQRLVSNEQT
AKSGREESYHPLSHSELHQDL
Download sequence
Identical sequences ENSGMOP00000018915 ENSGMOP00000018915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]