SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018948 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018948
Domain Number 1 Region: 1626-1666,1695-1890
Classification Level Classification E-value
Superfamily Plakin repeat 1.22e-61
Family Plakin repeat 0.0000129
Further Details:      
 
Domain Number 2 Region: 1529-1655
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000000000392
Family Plakin repeat 0.0093
Further Details:      
 
Domain Number 3 Region: 172-278
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000471
Family Spectrin repeat 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000018948
Domain Number - Region: 63-164
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000153
Family Spectrin repeat 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018948   Gene: ENSGMOG00000017592   Transcript: ENSGMOT00000019407
Sequence length 1891
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4481:42243:56783:1 gene:ENSGMOG00000017592 transcript:ENSGMOT00000019407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRTQATHLATLISRMQQSADKVEQEILRAEELLAVDAVNEKKELPFKHQHEISENMGEVE
GLLQALFLDVDKAKKMQHPQANEIKSDVSRLHERWLKDCAFYRDVYEQVNDVSLTPRIDW
GPVLNQKQKEVNVEAFGPTMADLEKQIASHNILHKELEAYSPQLSLGSVGNKEQYTALKK
QYNNLLDNSKWRQHYLQSLHEYMQGGTKESAFLADEQDKIKRQDWSDRMVDPPDVRRQYE
IFKSNSLLSHESEVNKLQDDGDRLLELKHPASATIMQKDAVRNDWQKYLNLCICQEAHLD
NVEEFKKYQLDTEQLAETLTRLNSTLDPKTISKQSNSQTLLQLETEEKSVQRAAALLADL
RRRSTSIAPLKLRRIAPTRAITVESLCDWETDKDTLAREERFTLKSNSDIENWIVVSPDG
TTKTFPGVCFIIPPPDPEAIDNVDMLGGELADIKKRRAALVTSLKSKHKTARSQQAAPVS
AAPMDPKAVALADQLDKLDSDLAQTEQDILSRLRAPLERGNTAADLAKRLKEQEKASKAL
KALEQQNIAAQADLQSLLAKDASLSSSALPLKLTEANNKKDSIAGLADLYTKVSGSQDEI
KKKYQETAPTSGARAPRSSSCRTATPTSATLKERENLLQEVSTKNQEFQATSKSLNSFLD
NMPVDQLKPTDDQAQLNAKEASQKRAMEDLQRKGDDMDRAVDLSQDLQSLLSVYELNADK
YNSNVEDAGATVAKRPHVPTLADAVQQQEKALVNRYAETSAENTQRLNQMSLSKNLIAQK
EEEVQMVEQSVQLQSQQRSSSEADGLQKELDEEKERLTYTETELRTFKERMMSLKSRRGV
ERVEDTEVLHYYRDPKLETDLVDFENKLHEESLKRSTTQGEIELITRKITITEETLKTST
PKLVTREVTEFEKDPQMDIEAAKLKSEIERIRDEMRVREGETIQMKTEVTILQAKKPNIK
ERVVKIEVVKVEQDPNMLRAVRNFEVEISDEGNKSKLINDDIFQTRSQINSMERIIQTIQ
PKVIIKEVMKIEQDPGLINESKKTSLEEVKIENNQLLTEITELQRRYREVQGWKPRIEVN
EIVNEIYRIDPNTEMEIMRIKKEIQETSRQCSELERQTTLVSSDLNVVRSEKPRVELKEV
LQEVVKEERSPENYKEITRLNDQVNQIHNSYNSILDRLRILRQERDQWKLEKSKVETKLL
TREVVKYENDPLLEKEADRLRKEVRDETQIRRTTEEMVFDLQNKYIILERQKPEEKVVVQ
EVVRLQKDPRLMMEHDKLGRKLDDEVKSRRQRDLELQQLRTKVEDTVRILRESDERQKKI
QAESELRELRLRIKQLENAPPPVEESIVVEEVLKVERDPTLERMTSGLRSDMDKETSEML
RIQREVRNITLKLEILQREKSGEKTVYKEVVRIEKDQVVEAERDRLREQVSRERFNRQDV
ENEIRRLTEKTNSLLSSKSSFSRKSKTLVASQDALQRERDDLARELRTLESSKHDISLSF
QQQTRLMSERTNINKQKSIKMDSDVHRLEREILGEKDKIHLSDNTIRELLLQLQKEEHAE
TRTKESHVSTKITILDPDTGVDLSPYDAYTQGLIDRKQYIHLQELECDWEEMTSKGPDGE
SSVLQDRKSGKQYSIKDALKKGWLTQNDLQKYKDGKMPISEFALLVAGDGKKAPKINSII
PSSITSAQSTPSQSISASTEIYPIAGVIDTNTGTCFTIRSASMRKMIDSVTAQRLLEAQA
ATGGIIDFNTKERHPVHRASDKGLIETSQLQRLLNAQKAFTGVEDPRTKELLAVGEAVQK
GWMPKETAIRYMEVQHLTGGLVDPKTGRRVSILDAIGAKLLDSGMLRELQSESCYAKEIT
DPVTKEKINYKQAMDRAKIDPVSGLPMLPTS
Download sequence
Identical sequences ENSGMOP00000018948 ENSGMOP00000018948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]