SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019029 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019029
Domain Number 1 Region: 91-336
Classification Level Classification E-value
Superfamily vWA-like 1.91e-69
Family Integrin A (or I) domain 0.000000618
Further Details:      
 
Domain Number 2 Region: 365-426
Classification Level Classification E-value
Superfamily Integrin domains 6.8e-16
Family Integrin domains 0.0014
Further Details:      
 
Domain Number 3 Region: 5-51
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000942
Family Plexin repeat 0.00096
Further Details:      
 
Domain Number 4 Region: 540-579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000725
Family Integrin beta EGF-like domains 0.0025
Further Details:      
 
Domain Number 5 Region: 497-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000363
Family Integrin beta EGF-like domains 0.025
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000019029
Domain Number - Region: 467-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0502
Family Integrin beta EGF-like domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019029   Gene: ENSGMOG00000017668   Transcript: ENSGMOT00000019489
Sequence length 717
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1365:98:118129:1 gene:ENSGMOG00000017668 transcript:ENSGMOT00000019489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGVLCRSSSITSCTECLRRGPQCAWCFQEQRCDLPVSLLRKGCSLEAMEHPEVKVEVNAT
LSGTQVSPSDIQVTLRPGSEASFIVAVSQLQRYPVDLYYLVDVSASMKENLDQLKTVGVA
LSHRMREHSSDLHLGFGSFVDKPVSPYINVHPSKINNPCSSDYEVRCRPAHGYHHILSVT
HNITEFSRVIERQLISGNMDTPEGGLDAMLQAAVCQRELGWRMGSKRLLLLMTDQPSHLA
LDSRLAGIVRPNDGLCHLENNVYTESTTMDHPSLNQLSDKLLENHIYSIFAVEKQQYQWY
KALVSLLPGSYLGRLGHFQAPNLIELVVDAYKRLLSEVGLEVLVEEGAGSRYWLSVSPLC
PEGSTANAHSCSGVLPNQTVYFNITIGMRSCPDEDEGTDVKVTVRPVGYNESTVVRVQAH
CRCRCGLPGRCRNPDQSQCRGGSKPVQEQGLAESGERKTPCRAEGAELECGGRGACECGS
CVCEQSKLGAVYGAHCEMDDFSCPYKDGLLCGGRGMCVSAECVCDLGWTGESCGCPVTPE
TCQTSDGAVCSGRGRCQCGRCVCDAPQNSGTFCEKCPICHGTCQSYWKCVDCHLAHGLLH
GEAGHCNQTCAPLVGYVDYISECAGSRPCRTFVWVCALTVFCGLVVVTLSMLLLQRQGRP
PGGPTVDLNYHPTSKDLSFIPTTNEKTVTYRRDHPPDRTGEMSIQVHKITFRDPWQC
Download sequence
Identical sequences ENSGMOP00000019029 ENSGMOP00000019029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]