SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019065 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019065
Domain Number 1 Region: 78-404
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-72
Family Protein kinases, catalytic subunit 0.00000735
Further Details:      
 
Domain Number 2 Region: 1402-1474
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000147
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 
Domain Number 3 Region: 1504-1625
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000226
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000019065
Domain Number - Region: 609-775
Classification Level Classification E-value
Superfamily Tropomyosin 0.0353
Family Tropomyosin 0.0011
Further Details:      
 
Domain Number - Region: 450-618
Classification Level Classification E-value
Superfamily Tropomyosin 0.0654
Family Tropomyosin 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019065   Gene: ENSGMOG00000017670   Transcript: ENSGMOT00000019526
Sequence length 2074
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1936:827624:872328:-1 gene:ENSGMOG00000017670 transcript:ENSGMOT00000019526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKFKYVSQGSLKMVPCSTDPITSRSSRINHLFQGRISLCGQEERCNLGREEFLEALLVL
YQECTSPDLMKMQHVSNFVHKFSEVVMELQALQPGPQDFEVRAVVGRGHFAEVQVVKEKA
TGDVCALKIMDKEVLRVAENVVFHEEERRILSLNSSPWIPQLFYAFQDTEHVYLAMEYLP
GGDLSSLLIRYEDQFDESMAQFYLAELVEAIHSVHQLGYVHRDVKPENVLIDRTGHIKLA
DFGSAAKLNSDKKVVAPAALVGTQDFLSPEVLSAMKGGQPALYGVECDWWSLGLIAYEMI
YGKSPFSDGTSAKTVHNILNFQRYLKFPEEVRASRLLVDLVQSLLCGARERLGYQGLRCH
AFFSSTDWNNLRQVLPPFVPKLQTEDDTSNFEEPEQAAPRSAPAAQRGAQTAGFKGHDLP
FLGWFFSRALTALAKAESVSAGINSPAKTNSMEKKLHLKSKELQETQDKCHKMDQEISRF
QRKMTDLESVLHQKDVELKASETQRTILEQDLATYITECSSLKRSLEQARVEVSQEDDKA
LQLLHDIREQSNKLQEIKEQEYHAQLEEMQVTIRQLEEDLSAARRRSDLYESELRDSRQT
SEDLKRKAVEYQQRIQKAKEQGKADVEELLSKLEKTNSDQQLKIQELQDKLSKAVKASTE
ATELLQNIRQAKERLERELERLRGKTEPSDTLKRRLRETEEGRKTLENQVKRLEMVERRE
NKLKDDIQTKSQQIQQMAEKILELEENLRETQATAQRMETHLAQNERLYEDKIKVVLEAQ
MKEDLVDKESLETKRAQHEQEAREKFKLISEQKATINAMDSKMKNLEQRISELSEANKLA
ANSSIYTQKNMKAQEEMISELRQQKFYLESQAGKLEAQNAKLEEHLDKMSQQEQTKRSRL
VELETRLREMGLEHEEQKLEIKRQVSELTLSLQERESQISGLQAARHALESQLSQAKTEL
EETTAEAEEEITALRSHRDEIQRKFDALRDSCSVITDLEEQLTQLSQENAELNRQNFYLS
KQLDEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNIETLKTTCSMLEEQVVELES
LNDELLEKERQWEAWRGALEDEKSQAERRTRDMQRLLDNEKQNRLRADQRSTESRQAIEL
AVKEHKAEIVALQQALKEQRLKAESLSDTLNDLEKKHAMLEMNARSLQQKLETERELKQR
LMEEQGKLQQQMDLQKSHIFRLTQGLQDALDQTDMLKTERTDLEYQLENIQAVYSHEKVK
MEGTISQQTKLIDFLQAKMDQPTKKKKGIFGRRREDVGTTTNGALMPLPPPPPMPLQYGD
MKLALEKERSRCSDLEETLQKMRIELRSLREEAAAHFKAQEHAGPSTPAQARQQILMSAI
VKSPEHQPNPSGLLNPSTRCKETATPEEFGRRVKERMHHNIPHRFTVGLNMRAAKCTVCL
DTVHFGRQAATCLECHTLCHPKCSPCLPATCGLPAEYATHFSEALCRDKANSPALQVKEA
SGHVRLEGWMKQPRNGKRGQQGWESKYVVLDGTKVSVFDGEPREDCAKAEEEFELCLPDG
EVSVHGAVGASELINTAKSDIPYILKLESHPHTTCWPGQTLYFMAPSFPDKQRWVAVLES
VVVSSHASKDKGETEAKLLGNSLLKLEGDDRLDINCTLPLTDQIVLVGSEEGLYALNVIK
NSLTHIPGLASVFQIQILKELDKLLMITGEDRALCLVEIKRVKQSLSQSHLPAQPDLNPY
IFETVKGCHLFSSGKIDNGMCICAAMPNKITILRHNESLNKFCIRKEIETSEPCSCIHFT
GYSIVIGTNKFYEIEMKQYVLEEFLDKNDVSLASAVFSASSHSFPISIIQVTKAPQKDEY
LLCFHEFGVFVDAYGRRSRNDDIKWSRLPLSFAYREPYLFVTYFNSLDVIEIQGHAALGP
HSYAHLDIPNPRYLGPAISSGAIYLASSYQNKLRVICCKGNLTQSQEAGSDLQRNGSGRS
PNKRGPPTYNEHISKRLAASPVVHGDPGTPHRYREARTEFRRDKSPNRPLEREXXXXXXX
XXXXXXXXXXXXXXXERQRLHTGSGRTPINPVNK
Download sequence
Identical sequences ENSGMOP00000019065 ENSGMOP00000019065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]