SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019068 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019068
Domain Number 1 Region: 246-525
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.99e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000511
Further Details:      
 
Domain Number 2 Region: 111-216
Classification Level Classification E-value
Superfamily SH2 domain 4.98e-32
Family SH2 domain 0.00000157
Further Details:      
 
Domain Number 3 Region: 3-106
Classification Level Classification E-value
Superfamily SH2 domain 2.42e-29
Family SH2 domain 0.000000806
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019068   Gene: ENSGMOG00000017724   Transcript: ENSGMOT00000019529
Sequence length 594
Comment pep:novel genescaffold:gadMor1:GeneScaffold_58:48834:60886:-1 gene:ENSGMOG00000017724 transcript:ENSGMOT00000019529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGR
EAEKLLTEKGKNGSFLVRESQSHPGDFVLSVRTGDDKTDSADNKPKVTHVMIRCQQDMYD
VGGGEKFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAEAT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRAENKNKNRYKNILPFDHTRVVLNDGDDTEA
GSDYINANLIMPELESKSNSTKLKKSYIATQGCLQNTISDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDVSALKEYGAMRVRNVKETAAHDYTLRELKLSKVGQGNTERTVWQYHF
RAWPDHGVPTDPGGVLDFLEEVNLKQESILEAGPIAVHCSAGIGRTGTFIVIDILIDVIR
EKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKIKGR
EYTNIKYSMLDLTGEQSPLPPCTPIPTPICTEMREDSSRVYENVGLMQQQKSFR
Download sequence
Identical sequences ENSGMOP00000019068 ENSGMOP00000019068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]