SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019091 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019091
Domain Number 1 Region: 114-277
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.28e-30
Family BAR domain 0.0063
Further Details:      
 
Domain Number 2 Region: 9-77
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.15e-21
Family DBL homology domain (DH-domain) 0.0017
Further Details:      
 
Domain Number 3 Region: 438-499
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000591
Family SH3-domain 0.00045
Further Details:      
 
Domain Number 4 Region: 345-423
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000998
Family SH3-domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019091   Gene: ENSGMOG00000017732   Transcript: ENSGMOT00000019552
Sequence length 504
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4617:687342:695008:-1 gene:ENSGMOG00000017732 transcript:ENSGMOT00000019552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQIYDLEGKPNLLNMGSLLIKPVQRIMKYPLLLGELWQATPNDHPDYLPLQEAYTAIKII
NVNINEFKRRKDIVMKYKRADDEGSLRERLQKINIRSIRKKGDRFAGYLKILAGAESQVK
DEAFDKEEKLFRSLEKAVKQLVKDVHFYLQQAQEMVAVAVHNVQDLEIIVKDSHKHITNG
TTRTDPYKHFKEQLERLVLTPLTCLQGMFSAPQKLIQKRYDKLLDYCSRLEPVSDTSPAR
RDYVALNGQLVEELQRFNAAAYTILVNSVVFLVALLRGLTDTTRHNIPSKHQLPAPLSNI
NEVQNSLMDELNNLTFVKDNAQKMMERKVSFERQREKKVEEVQHQTEPDRVWLLSEYPAS
QLYQLKRKCNGSQEQDLSLLEGDLVALLEDSDPHGSSSRWLVHPSGTQGYVYSTFLKQYN
PLRDVQGRPXXXXXXXXXXXXXXXFYAVHAFQARCEQELTLQEYQHVRILQFSDQGGNKD
WWLAEAHGQKGYVPANYLGKMSYA
Download sequence
Identical sequences ENSGMOP00000019091 ENSGMOP00000019091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]