SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019109 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019109
Domain Number 1 Region: 80-212
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.94e-24
Family DBL homology domain (DH-domain) 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019109   Gene: ENSGMOG00000017772   Transcript: ENSGMOT00000019571
Sequence length 216
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4617:695122:701584:-1 gene:ENSGMOG00000017772 transcript:ENSGMOT00000019571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASGGTEKEKEKVVKRRIRPVFLRYLDRRKTDSIVDDDMAVGDINLGTLVRRSQSDKTE
YSAKLKEKMTPSALSMPLPPDSEEVRCRKMSRRAKVIQELVQTEKDYLTDMELCVREVVK
PLRELQVVDVDRLFTNMEAACEVSAALVLQLQEATAEPDLEAVVIVGDIFIQAKGALEDV
YKIYCYHHDEANQLLKTYERDEEMKQHLNTCILSLK
Download sequence
Identical sequences ENSGMOP00000019109 ENSGMOP00000019109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]