SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019128 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019128
Domain Number 1 Region: 9-156
Classification Level Classification E-value
Superfamily EF-hand 5.86e-47
Family Calmodulin-like 0.00000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019128   Gene: ENSGMOG00000017790   Transcript: ENSGMOT00000019590
Sequence length 160
Comment pep:novel genescaffold:gadMor1:GeneScaffold_978:11325:13985:1 gene:ENSGMOG00000017790 transcript:ENSGMOT00000019590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDAQQEARGYLSDEMLAEFQAAFNMFDTDGGGDISTKELGQVMRMLGQNPTREELDEII
EEVDEDGSGTIDFEEFLVMMVRLLKEDQAGKSEDELAECFRVFDKNADGYIDREEFALII
RSTGEPISEEEIDELLKDGDKNSDGMLDYDEFMKMMENVQ
Download sequence
Identical sequences ENSGMOP00000019128 ENSGMOP00000019128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]