SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019177 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019177
Domain Number 1 Region: 518-768
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-73
Family Protein kinases, catalytic subunit 0.0000335
Further Details:      
 
Domain Number 2 Region: 86-159
Classification Level Classification E-value
Superfamily Cysteine-rich domain 7.03e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00071
Further Details:      
 
Domain Number 3 Region: 358-399
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000269
Family Pleckstrin-homology domain (PH domain) 0.0006
Further Details:      
 
Domain Number 4 Region: 212-257
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000598
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019177   Gene: ENSGMOG00000017821   Transcript: ENSGMOT00000019639
Sequence length 830
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2334:357:45936:-1 gene:ENSGMOG00000017821 transcript:ENSGMOT00000019639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRCSSASNPGGGGVAFHIQIGLSREPVLLDPGDLSLGQVREMACSIVDQKFPECGFFGMF
NKILLFRHDLSSDNILQRVGAAQDIQEGDLVEVVLSALATVEDFQIRPHALYVHSYKAPA
FCDHCGEMLWGLVRQGLKCEGCGLNFHKRCAFKIPNNCSGVRKRRLSSASQTAASPGPPS
AEFTPLPPEEVTTSRPLLAAGKRNSLLSGRPIWMEKMVLGRVKVPHTFSVHSYTRPTVCQ
YCKRLLKGLFRQGLQCRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSTNTNIPLMRVVQSIKHTKRRSSTVVK
EGWMVHYSSRDPLRKRHYWRLDSKCLTLFQNENAANYYKXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXDLSMSISVSNSQIQENVDISSVYQIFADEVLGSGQFGIVYGGKHRKTGR
DVAIKVIDKMRFPTKQESQLRNEVAILQNLHHPGVVNLENMFETVERVFVVMEKLHGDML
EMILSSERSRLPERLTKFLVTQILVALRHLHLKNVVHCDLKPENVLLASAEPFPQVKLCD
FGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIVYVSLSGTFPFNEEE
DINDQIHNAAFMYPPNPWKDISGDATDLITNLLQVKMRKRYSVEKXXXXXXXXDYQTWLD
LRGFETRRGERYITHESDDARWEEHADARGLPAPKHFIMAPNHDRMLEGH
Download sequence
Identical sequences ENSGMOP00000019177 ENSGMOP00000019177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]