SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019302 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019302
Domain Number 1 Region: 72-261,290-396,496-597
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.83e-51
Family LacY-like proton/sugar symporter 0.081
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000019302
Domain Number - Region: 418-443
Classification Level Classification E-value
Superfamily Plexin repeat 0.0327
Family Plexin repeat 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019302   Gene: ENSGMOG00000017940   Transcript: ENSGMOT00000019770
Sequence length 639
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4141:49001:88467:-1 gene:ENSGMOG00000017940 transcript:ENSGMOT00000019770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDRRRKVPDGGERSLIRAPSAAAGINTQPAFAQSSTSGPPPPPPSSTGDLERAARKQFQ
QDVTPGFVYVLAVFSALGGFLFGYDAGVIPGAMLLLKRQMSLSAGWQELLVSGTVAAAAL
AALLGGVLNGLLGRRVCILLASFSSTLGGVVLSAAPTKEALLAGRLIVGVGLAGIASMTV
PVYIAEASPHLRGQLVTVNTLFISAGQLTASLFDATFSYLPHDGWRYMLGLSAVPALVQF
VGFLFLPESPRWLLQHGLTQKARRVLSQIRGNQNIDEEFDSIKSSIEEEEKEAAEGPVLW
RMLTYGPTRRALLVGCGLQMFQQLSGVNAVMYYSATILQMSGIRDDRMAIWLSWLTALTN
FLFTLLGVWLVERVGRRKLTLGSLMGTCVSLVLLAVGFLSAQHTPPVTFPSDPALANSTC
VKYQVCEQCMLDPGCGFCYRDNGSVSQEEAPFASSCVPVNMASTERAAWGRCSNASQGRD
QTYWAFNYCPTPYSWLVLLGLLLYLAAFAPGMGPMPWTINSEIYPLWARGAGNACSAGVN
WSFNFLVSLTFLHTSQLLTYYXSPGAFFLYAGAASLGVVFVYAVLPETKGRRLEEVEGLF
EGRLCSCGATESDEGRQVEYIRVKGSNYHLSDNETSDVD
Download sequence
Identical sequences ENSGMOP00000019302 ENSGMOP00000019302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]