SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019356 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019356
Domain Number 1 Region: 195-333
Classification Level Classification E-value
Superfamily PH domain-like 2.37e-43
Family Third domain of FERM 0.000000227
Further Details:      
 
Domain Number 2 Region: 85-194
Classification Level Classification E-value
Superfamily Second domain of FERM 4.58e-37
Family Second domain of FERM 0.00000135
Further Details:      
 
Domain Number 3 Region: 2-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.48e-24
Family First domain of FERM 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019356   Gene: ENSGMOG00000017996   Transcript: ENSGMOT00000019825
Sequence length 444
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2297:17620:27178:-1 gene:ENSGMOG00000017996 transcript:ENSGMOT00000019825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISVRVTTMDAELEFAIQPSTTGKQLYDQVVKTIGLREVWYFGLQYQDTKGFSTWLKLNKK
VTAQDVRKESPLLFKFRAKFFPEDVSEELIQEATQRLFFLQVKEGILNDDIYCPPETAVL
LASYAVQAKYADYNKESHTTGYLSGDKLLPQRVLDQHKLNKEQWEERIQVWHEEHKGMLR
EESMMEYLKIAQDLEMYGVNYFNIKNKKGSELFLGVDALGLNIYEQNDKMTPKIGFPWSE
IRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQ
MKAQAREEKNQKKMERAMLQDEKRKREVAEKEKEKIVKEKEELMDRLRQIEDQTRRAQQE
LEQQTLKALQLDQERRRAQEEAGRLEKERHAAEEAKTALTQQAADHMKNQETLAAELAEF
TAKIALLEEAKRKKDEEASEWQHK
Download sequence
Identical sequences ENSGMOP00000019356 ENSGMOP00000019356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]