SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019357 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019357
Domain Number 1 Region: 35-344
Classification Level Classification E-value
Superfamily Sema domain 1.03e-74
Family Sema domain 0.00000308
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019357   Gene: ENSGMOG00000017944   Transcript: ENSGMOT00000019826
Sequence length 345
Comment pep:novel genescaffold:gadMor1:GeneScaffold_191:107814:114818:1 gene:ENSGMOG00000017944 transcript:ENSGMOT00000019826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCRHACCPLPGGLGTFVVSNGYKSVDPTQRVQVSYDSSDRGLVHFSQPNVRNTTTLLLSD
DGSTLYVGARNNILSLDVSDPEVITLKEEREDIEACSKKQKSAEVDCPNFIRVLQPMNST
HLYACGSYAYNPHDALLDIQTLTLTSVSAGAKGRCPFNPFERNTAITLGTPQQYKCSPFT
TFQSNSLRSLRRTSEWGAISPEPTFVSSAFDQKEGKLYFFFSEVLKEFNCMLEQRGARLA
QVCKDDVGGQRTLQRKWTSFAKSLLLCQPPKQQPFDLLQDMFTLQPPGGDSSRETLFYGV
FTSQCVPRSRGSEASAVCGFKIEDIRKVFSGDYRTFNPDKHHWST
Download sequence
Identical sequences ENSGMOP00000019357 ENSGMOP00000019357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]