SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019483 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019483
Domain Number 1 Region: 116-705
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.13e-176
Family Myeloperoxidase-like 0.000000000145
Further Details:      
 
Domain Number 2 Region: 709-760
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000153
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019483   Gene: ENSGMOG00000018101   Transcript: ENSGMOT00000019958
Sequence length 761
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1298:390794:397868:-1 gene:ENSGMOG00000018101 transcript:ENSGMOT00000019958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGSQFLEPALRRAMELTDAAYTRTSERVKMSLSEGALRPSDLLAQFKQAEPSTRAHIQAA
ELLDNTVELIREMVYTHTMVMPDHSKELLSDGDVAELLQVTGCSSELKSMHCDTDCLSER
YRSITGECNNRQRSSWGAANIPYSRWLEPEYEDATGMPRGWDPDHSYNGFSLPPVRLVSQ
EVLYTHNDNISLDSTLSHLLVEWGQWIDHDLALTPQSPSTAAFRTAVDCTRSCSRDTPCF
PIQIPSSDPRTGLQSCMPFFRSAPSCGRGPLGRGHREQLNAITSYVDASMVYGSSPGVAS
ALRDRLSPRGALALNPQHSDHGLAYMPFLSRGPQARLDPCGPRRGGNLSSSGPQDPHVPT
GDSRANEHLGMIALHTVFLREHNRLVEALYGLNPHWSPDTLYQEARKIMGAVHQVLTWDH
YLPRVLGESALSRLMPAYEGYNADVDPSVANVFAAAAFRFAHVTIQPMVARLGPGYSLDP
QHPPLALHHSLFASWRVVQLSGGVDPVLRGLLLSPAKLQVPGQMMVEELTERLFQAQGGM
PLDLGALNLQRGRDHGLPGYSSWREFCGLSVPNTTADLADVLGNRPLAHKFLELYGTARN
IDVWVGAISEPALPGGRVGPLLACLLARQFRALRDGDRFWWEREGVFTAAQRKQLRTASL
SRIICDNSHIQRVPADPFSRTESADAMLPCAHPLIPQLDLGPWKEPDPRCGVIPRVQYGY
SLLCGSVVLFQCRTGFTLQGPPSVRCDPGSQHWTPAPPICH
Download sequence
Identical sequences ENSGMOP00000019483 ENSGMOP00000019483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]