SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019499 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019499
Domain Number 1 Region: 1480-1620
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-51
Family Phosphotyrosine-binding domain (PTB) 0.00000138
Further Details:      
 
Domain Number 2 Region: 35-176
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.72e-27
Family Dual specificity phosphatase-like 0.00082
Further Details:      
 
Domain Number 3 Region: 1336-1465
Classification Level Classification E-value
Superfamily SH2 domain 2.42e-20
Family SH2 domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019499   Gene: ENSGMOG00000018092   Transcript: ENSGMOT00000019975
Sequence length 1625
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1695:95551:193055:-1 gene:ENSGMOG00000018092 transcript:ENSGMOT00000019975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSVVQVAEESFEVDLLYITERIISVSFGGGGEDSYGANLKEVVSMLRSKHGDHYLXXXXX
XXXXXXXXXXXXVLDFGWPDHHAPALDKICSICKAMDTWLSADSHNVVVIHNKGNRGRTG
VVVAAYMHYSNISASADQALDRFAMKRFYEDKVLPVGQPSQKRYVQYFSGLLSGNIKINN
KPLFLHHVIMHGIPNFESQGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVIHTEGP
LDGSLYAKVRKKESAEGSVTANGLPPTAVDHALPAVDHALSVSSDSGNSTASIKTDRTDE
EEQRQVPAATQQPLSLQEKQELDQLLSGLEGPLRRQGYLTAPPAQAAGRMLHLVPAQVHV
NGHNTMDRETDILDDELPTSQEGNSVDSLGTFSSTEGRATPADLYYQSEVIVTNGQDHVP
YLERSVPERPLESSRRHDAESGEYPMGLNGGLYRTQSCGGELKSMPRAPTRTTSSKDAVQ
RGLNVWQRFGVPEEPMTEGLSFSPPKASTAGQSSLSQFPQRRSTSQQEIEQSIETLNLLM
LDLDPGRPAVPKSQSAPLREASVVTTQPSFSQSQARPSYQADAAIHANHPAHPAGCPTAA
TSPPGLVPGPGFQGYASQRDGDSQASSGGVGHFQLKPINNYPPSTMALATEAPEMERSPS
AASASSQPREADSDEVFNVEGLVAQRVAGVQSRGISFEDPPSPRHRVPSDGGQFQNVPDG
SVDATCPDGPLRSPIRCVSPEFVNAIALNPGGRPKERHIHSYREAFEELEAGGPVSPSTL
AGGRSPPGLAKTPLSALGLKPHNPAEILLNQTGSGQRSYVESVARSASSSGDPPGPSSPQ
GLCPLGEAVLGSQRTPSPLSTQALNTPLSSSSPIQISSLPFQPTTDSGYHSQPMESLRPT
PSSSYQAPNTPTSQYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXGSPESRLNVKFVQDTSKFWYKPEISREQAICLLKEREPGAFVI
RDSHSFRGAYGLAMKVASPPPTVQPTKKAGDITNELVRHFLIESSPKGVKLKGCPNEPFF
GCLSALVYQHAITPLALPCKLLIPTTDLNEEAPVVPVATNPLAERLKQGAACNVLYINSV
DMESLTGPQAVAKAISETLAAGTPPTATVVHFKVSAQGITLTDNQRKLFFRRHYPTNSVT
FCDIDPQDRKWNKSEGGTAKLFGFVARKQGSTTDNVSHLFAEMDPEQPANAIVNFVLKMI
AAQKR
Download sequence
Identical sequences ENSGMOP00000019499 ENSGMOP00000019499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]