SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019622 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019622
Domain Number 1 Region: 377-519
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.36e-47
Family SPRY domain 0.0000653
Further Details:      
 
Domain Number 2 Region: 3-69
Classification Level Classification E-value
Superfamily RING/U-box 3.09e-20
Family RING finger domain, C3HC4 0.0063
Further Details:      
 
Domain Number 3 Region: 165-228
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000183
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000019622
Domain Number - Region: 208-283
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0157
Family BAR domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019622   Gene: ENSGMOG00000018231   Transcript: ENSGMOT00000020101
Sequence length 519
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4540:30049:42367:-1 gene:ENSGMOG00000018231 transcript:ENSGMOT00000020101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSEDQFMCSICLEVFVEPVSTPCGHSFCKACLQGYWDHSKKSLCPMCKKSYSKRPELSVN
RVLAEISTQFLGLTLAGGGGVDGGASRGSTLNLSSGAGASGSLRDGGSPSPDTNGDFARE
GEVPCDACIGRKVKALKSCLNCAGSFCETHLRHHKKVKSMSSHRLVDPTFHLEEKICKKH
QRLTELYCRTDNACICPTCADTVHKAHEVVSADREFKKQMANLSKRRSEVKHLIKERTKK
LEDIKQSIRVIKANAQKELEESWQVYAELQRLVEQSQAELVELIASRQREAERHAQELAR
GLENELSVLRRSSSELEAFAHTQDRIVFLQLPPPLEPLDWSAVSVSTDLYLGTVRSSVGG
LVDKFQVELQRLYGKGEVILDPGTAQKSLVLSEDGRQVRYDERKSSQTESSRRFNPALFV
LAREGLASGRHYWEVEVGRKTAWTLGVARGSARRKGDINLSPEGGFWCLWLKNGEIKALA
SSRVPLTAASQPAKVGVFLDYDGGQVSFYDAKSRLHLYT
Download sequence
Identical sequences ENSGMOP00000019622 ENSGMOP00000019622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]