SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019634 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019634
Domain Number 1 Region: 1-123
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.71e-25
Family Calponin-homology domain, CH-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019634   Gene: ENSGMOG00000018251   Transcript: ENSGMOT00000020113
Sequence length 136
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4311:15931:17302:1 gene:ENSGMOG00000018251 transcript:ENSGMOT00000020113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLGHLINSLSGGNPPIKKVQSSTMAFKQMELISQFLKAAEKYGVMVTDMFQTVDLWEGKD
LAAVQRTLMSLGSVAVTKNDGCYKGDPSWFHRKAQENKREFSDEQLMEGKSVIGLQMGTN
RGASQAGMSYGTPRQI
Download sequence
Identical sequences ENSGMOP00000019634 ENSGMOP00000019634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]