SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019678 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019678
Domain Number 1 Region: 29-140
Classification Level Classification E-value
Superfamily EF-hand 1.47e-21
Family Calmodulin-like 0.01
Further Details:      
 
Domain Number 2 Region: 370-437
Classification Level Classification E-value
Superfamily EF-hand 0.000000559
Family Calmodulin-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019678   Gene: ENSGMOG00000018277   Transcript: ENSGMOT00000020157
Sequence length 600
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2995:279394:294700:1 gene:ENSGMOG00000018277 transcript:ENSGMOT00000020157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPLDEETFYLKCRAVYISVFRSSLTSITSKQQLCRVLQLAGRNPSLKTLSKYWTPATSNL
NFDDFCEILKLEKQTDENELLRIFKGMDANGDGFISHSKLEKALTTSGEKMTAEEISAIF
SIADANKESKLDYAEFCRMLATTAEQCQSEALERLEADAKMRRQNFGSQIDGNPNPPASI
GITEARFPGTQKRLDTPSRVSSARSRRSPLSSTGVTMTASSVKASGKTLEPAALQNWQHV
GVRGCFFLEEEEGSISSLQYRFHLPQRSSVYLSIQPLSLGKVSSGSWMTVDTAIFVTSAG
QSKEECNLVCFTEARDEERYVWSGELAAGSYFLLPFTSGCRLRRRRRTATPTKPEPLVYR
TDSGELDLTRALREALSDIFDVIDLDGNGLISLEEYNLFELRTSGEKCDEEAWAICKETF
DTRRNQLTRQGFMELHLMEATEKDGDPSDLWLTLEAMGYNQALELVEACPFQMDVHCEGC
PPSLQPLSLDWGSRLLNQALQKSIVASAGEARALRGHDNVLVYTYRGDHRISSLVANKGI
QKVTVHVNNEHSKNCCSSRGMSVFAVEVPAKTKMVHQHVLPINERQEWTYCCVESTLPSQ
Download sequence
Identical sequences ENSGMOP00000019678 ENSGMOP00000019678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]