SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019719 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019719
Domain Number 1 Region: 3-209
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.37e-53
Family DBL homology domain (DH-domain) 0.00039
Further Details:      
 
Domain Number 2 Region: 199-318
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-23
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 3 Region: 372-546
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-20
Family Pleckstrin-homology domain (PH domain) 0.0000743
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019719   Gene: ENSGMOG00000018310   Transcript: ENSGMOT00000020198
Sequence length 550
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1811:122731:129177:-1 gene:ENSGMOG00000018310 transcript:ENSGMOT00000020198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKSKIHHIAMEIKSSENVFVDVIKLLHIDFREAVSKASNQSGKPVIEERFLNQILYNLPQ
LYELNQDLLRELEQRVHNWDENSQLADIFVKKGPYLKMYSTYIREFDKNVALLEEQSKRN
SAFGAVVRAFEASPRCANLALRHYLLKPVQRIPQYQLLLRDYLKHLPPASADYKDTQAAL
VIVKEVANHANDFMKQGDNFQKLIQVQCILNGHHEIVQPGRVFLKEGFLKKLSRKIMQPR
MFFLFNDTLLYTTPVQSGQFKLNNMLSLAGMKVSKPMHEAHQNELNIESVERSFILSASS
AAERDDWLQTISMAINDHTKKKISFISSKSTEIEENERVSGASLGSNAPIWIPDPRATMC
MICTCEFTLTWRRHHCRACGKVVCQACSSNKHCLKYLKNQLARVCNQCFVVLQQRSSEKA
LSTTQSPDGKSGFTFSRKHKRIPAALKEVSANTDNSSMSGYLQRSKGNKKQGRRLWFVIK
DKVLYTYAASENVAALESQPLLGFVLKEDSTQKLQFKLYHKNTIFYIFKADDVPAAQRWI
DSFKEAMVLE
Download sequence
Identical sequences ENSGMOP00000019719 ENSGMOP00000019719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]