SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019763 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019763
Domain Number 1 Region: 1-208
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.12e-82
Family Calpain large subunit, catalytic domain (domain II) 0.0000000418
Further Details:      
 
Domain Number 2 Region: 214-372
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 3.92e-54
Family Calpain large subunit, middle domain (domain III) 0.000000912
Further Details:      
 
Domain Number 3 Region: 385-545
Classification Level Classification E-value
Superfamily EF-hand 2.58e-38
Family Penta-EF-hand proteins 0.0000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019763   Gene: ENSGMOG00000018340   Transcript: ENSGMOT00000020243
Sequence length 551
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1038:143611:149275:-1 gene:ENSGMOG00000018340 transcript:ENSGMOT00000020243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FWQFGKWVDVVVDDRLPTKDGELLFVHSADSSEFWSALLEKAYAKLNGCYEALSGGSTIE
GFEDFTGGIAEKHDLLKAGPPLFKIIRKALDRGSLLGCSINITSAADSEAVTSRKLVKGH
AYSVTGAEQVAYRGDQVQLIRVRNPWGEVEWTGRWSDNSMEWRYVGDADRDRLKKSSEDG
EFWMSFSDFLCQYSMLEICNLTPDALTDTGVKKWALSEFEEGWRRGSTAGGCRNFTDSFW
KNPQFVIKLEEVDDDPGEGEKGCTVIVGLMQKYKRRMRKMGDDLEFMGFAIYEMPKEFSG
SRQVHMKKRFFQTKCSQARSETFTNMREVCNRFCLPPGEYLIIPSTYEPNHNADFYLRVF
TEKQADFEEIDDPIKCDIEQIEVDEDDIDDRFKSLFGKLSGKDSEMSMFELQKVLNKVVM
KRADIKTSGFSLTTCRNMITLLDKDGTRKLGLLEFKILWTKIEKLLILYKGKDADGNGFM
STTEMRLAVEEAGFSLSSPLHQIIVARYSEPDLTIDFDNFVCCVIRLEILFLTFKALDKD
HDGRIELKPLE
Download sequence
Identical sequences ENSGMOP00000019763 ENSGMOP00000019763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]