SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019788 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019788
Domain Number 1 Region: 22-66
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000994
Family Plexin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019788   Gene: ENSGMOG00000018394   Transcript: ENSGMOT00000020270
Sequence length 90
Comment pep:novel genescaffold:gadMor1:GeneScaffold_330:30021:31218:-1 gene:ENSGMOG00000018394 transcript:ENSGMOT00000020270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSVLLSACLLLALSPTGARKGRCPRKQSCDQCIRAGPECAWCNHPDITGPRCNTEERLVQ
AGCVRDLYNPRGGLLSVTNESVNVEATHCP
Download sequence
Identical sequences ENSGMOP00000019788 ENSGMOP00000019788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]