SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019827 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019827
Domain Number 1 Region: 163-316
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 8.63e-25
Family Toll/Interleukin receptor TIR domain 0.00078
Further Details:      
 
Domain Number 2 Region: 17-115
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000188
Family I set domains 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019827   Gene: ENSGMOG00000018427   Transcript: ENSGMOT00000020310
Sequence length 412
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1298:620354:639017:-1 gene:ENSGMOG00000018427 transcript:ENSGMOT00000020310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TESQCSRAPEFMPGGGLTPLWGRLGSTVWLNCTALVPWDPAEEPPCGPPTLQWSKDGRLL
TNRTEHPRNTSSWCVKTRSPSIGHVTLSSLLEISLQEQADFGLYLCIVRNTSAHFKQNAV
HTPSHTAAVIAAVVLLLLLSVAALVYSKHHLNIKLWYRNTYGDYELNDGKLYDAYVSYVN
NEYDRKFVNFILKPNLAKQGHKLHLNENDILPGAEPSAELLMNVSRSRRLVVVLSHAYLE
QDWCTRNFRQGLLHLLELSPKPIFITLEGQMKRARAEVREELREQQHRLTLLTWKHNSVS
LSSVFWKELVLALPRRLDFHCESARDPQTMLQEDKDPMLTLDPDYLDWRSEADPAGDLGR
RLPVYRASGVPMLGAFPTVPAELKHSDIDVSDLGSRNYGARTDFYCLVTKED
Download sequence
Identical sequences ENSGMOP00000019827 ENSGMOP00000019827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]