SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019871 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019871
Domain Number 1 Region: 209-347
Classification Level Classification E-value
Superfamily PH domain-like 6.46e-26
Family Third domain of FERM 0.0036
Further Details:      
 
Domain Number 2 Region: 3-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.24e-21
Family First domain of FERM 0.002
Further Details:      
 
Domain Number 3 Region: 89-189
Classification Level Classification E-value
Superfamily Second domain of FERM 3.93e-20
Family Second domain of FERM 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019871   Gene: ENSGMOG00000018448   Transcript: ENSGMOT00000020355
Sequence length 1031
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2424:34086:127519:-1 gene:ENSGMOG00000018448 transcript:ENSGMOT00000020355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEGRRCQVHLLDDRKLELLVQPKLMAKDLLDLVASHFNLKEKEYFGISYTDETGHFSWL
QLDRRVLEHEFPKKSGPIVLYFCVRFYIESISYLKDNATIELFFLNAKSSIYKELIELDS
DIVFELASYILQEAKGDFTSTEATRSDLKKLPALPTQALKEHPSLAYCEDRVIEHYKKLN
GQSRGQAIVXXXXXXXXXXXXXXXXXXXXDKQGIPWWLGLSYKGIFQYDHQDKVKPRKVF
QWRQLENLYFREKKFSVEVHDPRRASVTRRTFGHSGIAVHTWYACPGLIKSIWAMAISQH
QFYLDRKQSKSKIHAARSLSEIAIDLTETGTLKTSKLANMGSKGKIICGSSGSLLSSGSQ
ESDSSQTAKKDMLAALRARQDALEETLKLRLEELKNICIREAELTGKLPKEYPLDPGEEP
PTVRRKIGTAFKLDEQKIPPKGEEEELERLEREFSIQSQITEAARRLASDPHVSSKKLKK
QRKTSYLNALKKLQEIENSINEHRVRSGKKPTQRASLIIEEANIGSEDSSLSDALVLDDD
DSQVTGTPTFSPVASPHKGLPPRPPSHNRPPPPQSLDGLRHLHYTRMDYDKSPIKPKMWS
ESSLDEPYEKVKKRSSQSHRRFPSPGGTEPGGSDSLQSSPVRSLPGWSSQSSMPSTPDLR
TRAPRYVHTTRSVDISPTRLHSLAQHFRNRSSSLESQGKLLASDPGASHPRPRGALGSPD
FFLGPGRSNGSDPLDDCSSCTSHSSSEHYYPGGGPPGGNPNYSTLGEDSPSKARQRQRQR
HRSAGHLGSSNSGSMPNLAAKNGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXASPHSQRSMTPSSELAATPTPPCSPQHILNWQSGVTAESSPTDDA
SQSHTQPSSDA
Download sequence
Identical sequences ENSGMOP00000019871 ENSGMOP00000019871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]