SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019921 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019921
Domain Number 1 Region: 2-400
Classification Level Classification E-value
Superfamily Sema domain 4.32e-112
Family Sema domain 0.000000143
Further Details:      
 
Domain Number 2 Region: 401-451
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000244
Family Plexin repeat 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000019921
Domain Number - Region: 466-533
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00154
Family I set domains 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019921   Gene: ENSGMOG00000018516   Transcript: ENSGMOT00000020406
Sequence length 541
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4555:29707:37762:1 gene:ENSGMOG00000018516 transcript:ENSGMOT00000020406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDWSPSENDLQQCSMKGKEMVMDCPNFIRVLQFLNTTHMYACGTYAFSPRCTYMENLTMT
SQSSKPEEGRGRCPYDPYQRNTAITVDGELYTATVADYRGNRPVISRHLSPVDLKLDDTL
GWLEDPTFVSSSFIPSEEKIYFFFSEVGREYDFIDKFIVSRVAQICTSDVGGQRTLQRRW
TTFAKAQLLCQASSELPYNVVQDITDLPPPEGAPADDTLFYGIFTSQWSVFVRSVNSGQS
AVCAFRLGDIKATFSRNYKVLNRDTLRWSTRVQEKVANPGECGLHNASDNTLRFVKDNFL
ADDSVQPVGRSLTMVSHDKKYSHLAAQRVRAANHRXXXXXXXXXXSGYLHKAVLLEQGAH
IVEEVQVFEQHQSTVGMQLSVSQGVVFVGTSEGVVRVPVANCSFYPSCAQCVLARDPLCG
WDHLGRACVEVSASPASLGQDVDEGNVEQVCLTASLSPRSRFGLDQLTTVSVSLNEVVRL
QCPGTSRHAQRTWERPDSRISPDLYLHPGDGSLRFVVTPATLGKYLCLSTENGHRQTLAV
Y
Download sequence
Identical sequences ENSGMOP00000019921 ENSGMOP00000019921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]