SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020049 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020049
Domain Number 1 Region: 1600-1727,1912-2098
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.33e-45
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 2 Region: 23-210
Classification Level Classification E-value
Superfamily Sema domain 3.66e-45
Family Sema domain 0.00087
Further Details:      
 
Domain Number 3 Region: 360-470
Classification Level Classification E-value
Superfamily Sema domain 7.85e-24
Family Sema domain 0.0068
Further Details:      
 
Domain Number 4 Region: 1056-1152
Classification Level Classification E-value
Superfamily E set domains 6.62e-16
Family Other IPT/TIG domains 0.0085
Further Details:      
 
Domain Number 5 Region: 1149-1241
Classification Level Classification E-value
Superfamily E set domains 0.00000000000013
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 6 Region: 473-525
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000471
Family Plexin repeat 0.0032
Further Details:      
 
Domain Number 7 Region: 1238-1283,1321-1375
Classification Level Classification E-value
Superfamily E set domains 0.0000000065
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.062
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000020049
Domain Number - Region: 1385-1443
Classification Level Classification E-value
Superfamily E set domains 0.000448
Family E-set domains of sugar-utilizing enzymes 0.055
Further Details:      
 
Domain Number - Region: 628-660
Classification Level Classification E-value
Superfamily Plexin repeat 0.00458
Family Plexin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020049   Gene: ENSGMOG00000018622   Transcript: ENSGMOT00000020543
Sequence length 2131
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2216:82462:171356:-1 gene:ENSGMOG00000018622 transcript:ENSGMOT00000020543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGRVSSLTPPALWGWCSAPLDPSFSRNDTLFEHLALHPDPSVGRVYVGGRDRLYQLDRAL
ALELQDDTGPVTDSRECLPPVTQGNCPQARLTPNHNKLLLVDPYSMELIACGSVNQGICQ
KRSLVNISAVLFSAQRPVDTQYVAANDPEVSTVGLVVRSRPERQPVLYVGRGYTSSHPPI
STRNLQQEPVFSYEETAKLAVAGRLSEYDHHXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
NTLEAYPCGSDHTPSPMASRTPVVAETILHSPSARLTAVAVSVRDDHTIAFLGDSKGNLH
KVYLGPNGEVEEYAVVPVQPNTPISSDLILDQKEEHLFIMTSTMLQKRPVAECHIHTDCD
SCLQGHDPYCGWCVLEGSCALQSQCKRSNKTGQWLWSFDMEQQCLSVQDLQPSNVSRDQS
RMIALSVPGLPGLGEGEGYSCLFQDGSSTAATTTPTGVTCRSPDPSRVPMVQSGQDSITV
TLSVRFGGVSVTQRDFTFYDCTAVKQLSGSKPCHGCVESRWGCNWCVHQHLCTYKSSCEE
GVVIYNQHPIVSTLLSQFKLPTSAPPTNRPPPVPPTLPAVPATTSTTSTATSTTSTTSTT
TPTTTPTTTSTTPTTTATTPVTTPIAPTTATQAPPTPTTTGPTLGPTTPAPPTTLEPAAP
AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXNDTVSTFSAATLLSGDGEGGRDPAASFPRLMDTDSEPDYQYDVSDGFLPGDEGSYVS
VGPSACPCVEKVQGSSLLPVQVERKITLLAHNLHLYQDKEYQCVLVIEGQTVVVDAYVET
DEFNSSIFYITCQQHKYSYTSLEEENDALVFVKRRDTFHVDSDPSLRVTLYNCSAGRADC
SRCHTVDRKYDCVWCGGRRASCLYSESCGSEAVQQTCPAPLIHKIEPLSGLLEGGTQVTI
WGSNLGQKAEDVLHTVRVVSVPCTVIPGLYQISTRIVCKTQASGGEKVGQVSVEVSGGER
GLSSQMFSYQDPFVMGVSPERGPKAGGTALTITGRRLLTGRPSGLTITVGGVPCSIVSEV
KEASVVCVTGASNRSGEQRVTLHYGASQRHLHTSLYRYTPNPNVTRAAPASSFLNGGRLI
YVWGHSLDVVQEPRMVVTIAPLDPISQTRRRRRRRSGGGRLIRMVADLVCSSDPLCYVKQ
FTERCEVNSSSLILCRSPAVDESVWGSEVTVEFLLDNLRFPFSGLSAQLFHYQPNPLLHS
LNRQEPLKAYRYNPGSFIQLEGENLDLAITKEEVVVLVGEGVCAVKTLTRNHLYCEPPPQ
QPGPGPNGKKREGSDSLPDFTVQMGNLNFSLGKVQYDTMSLATFPMEARIGVGVGASIVA
LIVFIIVLIYRRKSKQALRDYKKVQIQLENLETSVRDRCKKEFTDLMTEMMDMSSDLVGS
GIPFLDYKKYAERIFFPGHRESPLRRDLDVQECRRQTVEQGLVQLSNLLNSKLFLTKFIH
TLEGQRTFSPRDRAYVASLLTVALHGKLEYFTDILKTLLNDLVEQYVAKNPKLMLRRTET
VVEKLLTNWMSICLYAFLRDSAGESLYMLFRAIKHQVDKGPVDAVTGKAKYTLNDNRLLR
EDVEYKTLNLNVLTQGGGVNESQPLPSKVLDIDTISQVKEKLLEQVYKGTTYSQRPHVDS
LDLEWRSGVAGHLILSDEDLTSVVQGNWKRLNTLQHYKVPDGATVVLVPRHSKHIHHDNH
DYVAGEKTPMLEDADEGGVRLWHLVKAGEEPELPKHRRGSLRERERAKAIPEIYLTRLLS
MKGTLQKFVDDLFTVILSTSRPVPLAVKYFFDLLDDQAAHHGITDPETIHIWXXXXLPLR
FWINIVKNPQFIFDVQASDHVDAVLSVIAQTFMDSCTVAEHKLGRDSPINKLLYARDIPR
YKQMVERYYADIRQTISASDQEMNSALAELSRNYSGELNYLVALHELYKYINKYYDQIIT
ALEEDPTAQKMQLGYRLQQIAAAVENKVTDL
Download sequence
Identical sequences ENSGMOP00000020049 ENSGMOP00000020049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]