SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020125 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020125
Domain Number 1 Region: 252-438,506-553
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 6.54e-40
Family Phospholipase D 0.037
Further Details:      
 
Domain Number 2 Region: 564-770
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.38e-25
Family Nuclease 0.05
Further Details:      
 
Domain Number 3 Region: 23-100,127-163
Classification Level Classification E-value
Superfamily PX domain 0.000000000196
Family PX domain 0.0053
Further Details:      
 
Domain Number 4 Region: 175-277
Classification Level Classification E-value
Superfamily PH domain-like 0.000000401
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020125   Gene: ENSGMOG00000018723   Transcript: ENSGMOT00000020623
Sequence length 903
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4244:248965:264503:1 gene:ENSGMOG00000018723 transcript:ENSGMOT00000020623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFLVVHALLDVKKIGVPILMTGAPITCRVESTERHTTRSKQVSVCTLYTVRLTHGPFTWT
VKRKYRRFQELHRDLYKHKMLMHFMPMGRWAAHLSICKGEATAADDVGGDAQPQQLRQGS
ENLQQAGMTQPNKYLEEYLNGLLENEFCKNDHGMLEFLDVSALSFINDLGAKGLEGPIFK
RSGGHRIQGLNCIGHHQFCYRWSRRWLVVKDSFLLYMNRDHGVISFVLLFDPELKVKVGN
SYTDTKHGVCIENFTRDLIIKCSNYRQAHWWSHEIDNITVACDFVRWQRYEGFAMPRENT
LTKWYVNGSGYFSDLADALEQAKEEIFITDWWLSPEVFLKRPATDSYWRLDEILKRKAEQ
GVKVCVLLYKEVELALGINSGHSKRTLMDMHPNIKVMRHPDVSSVVILWAHHEKMVAIDQ
SVAFVGGLDLAFGRWDDSQYRLTDLGGNDVPDGPEPSEPPEDLDPKDLAENTKLWLGKDY
SNFIRKDWVQLDRPFEDNIDRTQVPRMPWRDFSAAIHGKAARDVARHFIQRWNFTKTFKN
KYKDDFYPCLLPKSHSTAEKLPFTVPGSGRATVQVLRSVDRWSAGTCEQSILNAYVDVIE
KSEHYVYIENQFFISCADDKSVYNGIGDAIVNRILRAHSEQKTYRVFVVVPLLPGFEGDI
NEGGGNAIQAILHFTFRTMCRGEHSILTRLREAVEDKWTEYITLCGLRTHGRLADAPVTE
LIYVHSKTLIADDRRYIIGSANINDRSMLGQRDSELAVLVEDEDRVPSLMDGKEYQAGPL
ALALRKECFRVLVGAASEPSINIDDPICDEFFFLGWNAAAKLNATIYEKVFCCLPSNSVH
NMRELRENAGKERLCDSDPQQACEELGAVRGLLVHFPLQFLCEENLLPPLNSREGIVPVG
LWT
Download sequence
Identical sequences ENSGMOP00000020125 ENSGMOP00000020125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]