SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020178 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020178
Domain Number 1 Region: 6-489
Classification Level Classification E-value
Superfamily Sema domain 9.42e-181
Family Sema domain 0.000000000000162
Further Details:      
 
Domain Number 2 Region: 485-536
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000279
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 3 Region: 545-618
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000515
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020178   Gene: ENSGMOG00000018773   Transcript: ENSGMOT00000020676
Sequence length 620
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3659:180352:212645:1 gene:ENSGMOG00000018773 transcript:ENSGMOT00000020676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPPSLTEMLESSNLLTFNGLANSSSYDAFLMDEERGRLLVGAEDHIFSFDLVNINRDHKQ
IAWPATPSKRDECKWAGKDYVKECSNYVRVLQPFNHTHLYICGTGAFHPICSYLEMGKRA
EDNIFRLASHFENGRGKSPYDPKMLSSSLMIDGELYSGTSADFMGRDFAIFRTLGDQHPI
RTEQHDSRWLNDPRFVGVNLVPESDNPEDDKIFLFFKENAMDGEHSGKATIARIGQLCKN
DMGGHRSLVNKWTTFLKARLMCSVPGANGIDTHFDELQDVFLMSSKDPKNPVIYAVFTTS
SNIFKGSAVCMYNMADIRRVFLGPYAHRDGPTYQWVPFQGRVPYPRPGTCPSKTFGGFDS
TKDLPDDVITFARGHPAMYNPVHPMGGRPIVVRTDVDYQFSQLVVDRVEAEDGQYDVMFI
GTDMGTVLKVVTIPRESWHDLEEVVLEEMTVFREPTPITAMELSTKQXXXXXXXXXXVSQ
MPLHRCEVYGKACAECCLARDPYCAWDGTECSRYFPMAKRRTRRQDIRNGDPLSQCSDLQ
HQGVVEERSVYGVENSSMFLECSSKSQRALIYWQLQRPNEERKLEMKLDERVLRTAQGLL
IRSLAQADAGVYHCHAVEHG
Download sequence
Identical sequences ENSGMOP00000020178 ENSGMOP00000020178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]