SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020184 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020184
Domain Number 1 Region: 1276-1444
Classification Level Classification E-value
Superfamily PH domain-like 2.64e-67
Family Pleckstrin-homology domain (PH domain) 0.0000058
Further Details:      
 
Domain Number 2 Region: 1074-1275
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-43
Family DBL homology domain (DH-domain) 0.000000174
Further Details:      
 
Domain Number 3 Region: 477-594
Classification Level Classification E-value
Superfamily PH domain-like 2.57e-18
Family Pleckstrin-homology domain (PH domain) 0.0042
Further Details:      
 
Domain Number 4 Region: 870-939
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000186
Family Interleukin 16 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020184   Gene: ENSGMOG00000018751   Transcript: ENSGMOT00000020682
Sequence length 1689
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1441:128328:182307:-1 gene:ENSGMOG00000018751 transcript:ENSGMOT00000020682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSESQYSIQGPKGTSFFFPVKQKPYSLKFPSSKEDDLSPHTWWKNAPRGSGFKARSLG
RGCLSPARSRPPYSSGHYDYISQGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXEQSSPRVVIEKDGSLRVEFTNTPGSPLVVEEVGGPVQLLKFSPN
VDAAAAAPGLPGSRGGPPPGPASSMARTSKGSSLSSDGSWYDSPWGPSAELCAEQEPPCS
ASRTLILSPGHESLDEHESSPMSVPELYRDPTMAATFPATVEPACLYQPVHKPYRASFAS
ALDVPAEEENAEARQYSSYTLPCRRPKAHTLSEDKKDSIKNRIRRLSDWTGSLARKKKSQ
EQRHKAPSDAFDSGVDGLTADTSSPSQVSSLPWFPGASAASRAQSQGALHQASGDAVRQN
IYENFMRELGDGGRGGAGGGGRKDESTGTGEEESSSESPEGSLEQLDLLFEKEQGVVRRA
GWLSFKPLLTLHKDRKLELVSRRRWKQYWVTLKGCTLLFYETYGKGSPEQEGSPRYALLA
EDSVVQAVPEHPKKENVFCLSNSYGDVYLFQASNQTDLENWVTAVHSASASLVAKRQGKE
DTVRLLRGQVRGLLQKVDMDGKMKKMAELQLTVVADPKNRKAIENQTQQWEQNLERLTLP
NPKSLLATAGRPRALGRLGIFSVSSFHALICSRDEATLRRRRRRSSVTLASRQRKRGLFS
SLKGLDNLTLRGRDKRPSVSQIFESTSGXXXXXXXXQSSCPNASNIYSMSPPEGGVWESS
SGSAGSEALAHVRTPDGLTLQLPIRADLTAAQLLASACKVKQLDAGLHGLRLHXXXXXXX
XXXXXXXXXXXXXXMCDHLEVVPLNVFNLHMRRPSGTGDFGFAVTGHIDAQKNSRIFVNE
VLPDGLAIDKGLRPGDEILVLNGRCVSGLDLVLIQTLFAEQQLSLSLRRXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXLYQSFQDGPVSGAKGAAAASKGLQVRPCQRHMSPTERLCKVI
QELVDTEVLREGLDLACLFDIYLKPLQDETFLTLDEMESLFGSLPEMLDFQRVFLQTLEE
KIASSPDFSTLETPAQFKRLLFSLGASFLYYADHFKLYSGFCANHIKVQKVLERVKTDRA
FKEFLDARNPTKQHSSTLESYLIKPVQRVLKYPLLLRELVSLTDVESEEHYHLNEALKAM
EKVASHINDMQKLYEDYGAVFDQLVAEQTGHNKEVTEISMGEFLMHSPAVWLNPHPSLGR
MRKDPEMTVFVFKKAVILVYREHYKLKKKMFVCDKQTTSRSSTSQGDTDPFKFRWLIPLS
ALQVRLGNTAGAGTETSCIWELIHTRSEVEGRPETIFQLCSSVPEYKANVVKVMRSILRE
NVRRGTKGDAAPDRGCRERLAPLRGTLPSSARIGSSRASWLSRKTRSNSTHSSKTKAGPD
SDESSQSSSAPGSSGTAPRHLHGSPLSPAQESWSQDSGCHSQPSSSSVKESDALSDEDAD
AGFGARATSGGRAGALEARFLQLQLSEEAPAPRVQPEGAEVNTPESQHRAPHAHYSPLKR
KPSGGLRRSPGAPGSLKGRSRSLDSQADTAAAVAATVMDINSLLEREFSVQSLTSVVNED
CFYETQGDT
Download sequence
Identical sequences ENSGMOP00000020184 ENSGMOP00000020184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]