SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020226 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020226
Domain Number 1 Region: 189-573
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.71e-150
Family Myotubularin-like phosphatases 0.0000000000477
Further Details:      
 
Domain Number 2 Region: 78-186
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-27
Family GRAM domain 0.0000771
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020226   Gene: ENSGMOG00000018828   Transcript: ENSGMOT00000020725
Sequence length 578
Comment pep:novel genescaffold:gadMor1:GeneScaffold_184:195:7078:-1 gene:ENSGMOG00000018828 transcript:ENSGMOT00000020725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAGSHVEWCKQLIAATISTQISDPAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXQDVMYICPFSGLVTGMLTLTDYKLYFNSLEREPPFFLDVNLG
AISRLETINVQSHGEDSRGLELVCKDMRSLRFAYKKEADQPELVDLLARYAFPLCKGLAL
FAFQYQEDFPVNGWTVYDPVMEYKRQGLPNESWALSRVNSSYQLCDTYPSLLVVPTCIPE
DDLRRVAAFRAKHRIPVLSWIHPESQATIVRCGQPLVGPHDRRCKEDERLLQTVMDANAQ
SHKLLIFDARQSSVADTNKAKDGGYESESFYPNVELSFLEIPNIHVMRESLRKLKEVVYP
TIDEASWHSSVHQTHWLEYIRLLLTGAVRIADRLESGKTSVVVHCSDGWDRTPQLTALAM
LMLDSYYRTLQGFQVLVEKEWISFGHQFTARVGHGDEDHASSERSPLFVQFIDCVWQMTR
QFPAAFEFNELFLVSVLDHLYSCLFGTFLCSSEREKGAQELQSKTKSLWSYINSQPEEFT
NPFFVDQEHHVLYPLASSRHLELWTGYYARWNPRMRPQ
Download sequence
Identical sequences ENSGMOP00000020226 ENSGMOP00000020226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]