SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020248 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020248
Domain Number 1 Region: 14-114
Classification Level Classification E-value
Superfamily EF-hand 1.08e-25
Family Calmodulin-like 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020248   Gene: ENSGMOG00000018859   Transcript: ENSGMOT00000020747
Sequence length 115
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4435:54:1363:1 gene:ENSGMOG00000018859 transcript:ENSGMOT00000020747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNHGSNLDDILAEDMHHWYNKFMRESPSGLITLFELKAILGLKRMTEDANGYVDQVFMT
FDMDGDGYIDFVEYIAAISLMLKGEINQKLKWYFKLFDQDGNGKIDRDELETIFS
Download sequence
Identical sequences ENSGMOP00000020248 ENSGMOP00000020248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]