SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020271 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020271
Domain Number 1 Region: 37-228
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.18e-38
Family Regulator of G-protein signaling, RGS 0.0000149
Further Details:      
 
Domain Number 2 Region: 405-480
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.2e-16
Family DBL homology domain (DH-domain) 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020271   Gene: ENSGMOG00000018768   Transcript: ENSGMOT00000020771
Sequence length 482
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4630:45944:60855:1 gene:ENSGMOG00000018768 transcript:ENSGMOT00000020771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVFGALNSNPAMSIIGAEDEDFENDLNEVPDSQCPHFNCIEKLKARPTHLLVFLHHVILQ
FDCAALLCVCVCVSSYIPELVPQLYKLKMDLFFLNYSFFFSVQILKVVVPAAVSNELDRT
RPELLTEDLQRRYVQEVQSQQEAEVAKQLEDFRCKRMMGMTANETELVDVENHYPTDRIP
MEMKEKSVAEVMLDKMAENQANIVADEDRCQAIFASVAVYLKHLGVKSRAVDSKKSRGGF
FRRPLGKNKKDESTKTKPRGGFPSIPSWIAGSSTSLFISVDLKDSHPKAHPEASCFVLFS
SDRSFSQTQIFCVVFYNYHAPRSVRTASFCPPGGTPSPSPSPAGSPAPLGGAPPPPSPPW
RSASAQGSAPAPPAAQTATAKYLYPSPQPEEMEPRLVELEQDPANWRELADRNALANLSK
KETKRQEVINVILTTEHAHYRMLTVLQTVFSKPLEREEILTGPELATIFPSLEEILEMHC
EY
Download sequence
Identical sequences ENSGMOP00000020232 ENSGMOP00000020271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]