SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020283 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020283
Domain Number 1 Region: 1-117,157-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.74e-68
Family Calponin-homology domain, CH-domain 0.0000854
Further Details:      
 
Domain Number 2 Region: 5614-5769
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-17
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 3 Region: 5394-5516
Classification Level Classification E-value
Superfamily Spectrin repeat 6.12e-16
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 4 Region: 5963-6074
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000288
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 5 Region: 5308-5407
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000127
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 6 Region: 1346-1453
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000244
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 7 Region: 6031-6156
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000342
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 8 Region: 5005-5115
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000107
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 9 Region: 3360-3479
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000767
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000020283
Domain Number - Region: 2184-2252
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000928
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 5184-5290
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00101
Family Spectrin repeat 0.022
Further Details:      
 
Domain Number - Region: 2210-2344
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0054
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 2326-2449
Classification Level Classification E-value
Superfamily Spectrin repeat 0.023
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 571-653
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0327
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 1791-1884
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0535
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020283   Gene: ENSGMOG00000018765   Transcript: ENSGMOT00000020783
Sequence length 6238
Comment pep:novel genescaffold:gadMor1:GeneScaffold_107:29283:191064:-1 gene:ENSGMOG00000018765 transcript:ENSGMOT00000020783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQVQIQKRTFTNWVNAQLAKRKPPCAVGELFSDFCDGSRLLDLLEVMSGQRMXXXRGRGI
FQHRSNIETALNFLKSKSIKLVNINIPDIIDGKPSIILGLIWTIILQYHIEELASSLSFS
SRQASMESLASLDTRSSLSRASPRSSPLPGRRASPLHNRFKVSAKKALLLWVREQCHKAG
YTLTVKDFKASWRSGVVFLAILYSLRPDLVDLSKARNRSNLQNLEEAFGLAERELRIPRL
LEPCDVDVRDPEEKSIMTYVSQFLQYSRDLPIPEEGVQATPNQKAQEVTCWLLQAYEELL
EGWDSTEGESYAERYHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXACL
EEMPQQVRNFQMFQNVDESGNLLVPTDKLDEMKRRFTSVRVTAKYHGIKLEYQEQRHTVL
ELLARIRPKLRSWRRPYVSQESVRVLLQEWHELVNEQQLPSLLEAALQKLKHVSGKYSSK
SALDYGQVKQQVEEVEEESGAPEGVAGVKSSLARVLSAWESFSDTLSSLMAWLEQGSLAR
PPQVSSEAMSEWSSRQTHLNQVGEFLMEVSDPQTTRTLADDLRRINQRWAQQQHHQHSQQ
KQQHNPKDKQMEQQDVPQQKPPVHPEAPVQKHMGARAKELPEATPQPPRQPEEQKKPLSQ
KELQSRKAQGRKNRPWLQKKPSDECHPPFSQSPVQPQIYPTDSLSHNHKESLRTLDPDLL
EGFLRAAESMEAFCTPSQLQDMELFTQSVQMQWEAVRTEISRYKQQVQFEVTREAFNTAA
LQCDTLLGSRLAADSQVDKRLAGNSECFSAQGSAPQAGGHLEALRELCGTLSPEDSHRLA
QAQLRECEKRLAAIQRQFSGEADPPAPTQPPETGXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLAQMAKNEQILQELSGDSV
SLKGLHTRLQEIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXA
LGGALRQIDSTQNHMVDFIDRLDRYLRQPKDVSAFTLASSTVGDIKELDDSIQSELDQLS
RLDPVDSSSWPLSQEVASHRASLDQLRQQVRKSEAAARALDRFLMSLRSVEQDVAGVQSA
PCSDPALLQESRARLGLSRQSVGSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
LRALSDLEVQLKTQRSELQTLTDLHGEGGGAEEQLQPLKAQWEETQAAVTDRLEECNTLM
ELLKKFQGCRGYVSSTMQKAEQVMGEQASYMGKENLQRLIAKVHDIKEDLRGVGVRMEEV
RFVSRQLTAHLKNMPDCSEAPFEAESDVLMDGWLDVTEKSESYMDNLQVALEQWERQLGL
GAEVEAWAAAKLAVFAESHPFHSEQQVLDMRDEIQSHEENIERFHKKSVEIQEMLQSQDP
PLELQVVETQLRKKMEQVQELFSDSTDVFEELMAVKKHLAEKIQECAAAVENIQTSINNV
STDLSEDLDFQEEKAQGVVRELDLISSVASPEALEPLTQDAYRLKHAFSLGRELIQRRRD
DQGKDLATAIRDDNQRFDEFFQDLQLSINECFENPXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXELTSWLEEQQKEVSTFATHCSNRQQQMQSTLNTFKSLQE
QYDAFQQWLKYKEEDSVESDALLCPCQAVLVSRPDGDAQVDDLRRRGQSVCKCEDLEEGR
RREVQQTVEATAEQWRNVLQRAENLNDFKSQKESVLSWVRQQAQTLRSVGGHMTFEERLQ
IPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
QAVLGSKPEGDGKVDDLRRRGQSVCDRKEVQQAVREAAEQWSSVLEKAEEVLHRAELXXX
XXXXXXXXAEEVFETTQDPTWRDPTWAGMEECLPGLLSELTVSAALEEGEKLQHSLREAL
SHRQFLVDSLKVGEAERLERESSEXXXXXXXXXXXXXXXXXXXXSKEARLRLVSLYTGQT
EVARATLEGLETELEAVPEETSSNEEERLHSFLRHMEENRTVLGELVLTHSELVPHLSPS
NQGTVQRQLRALQDRWRSLENAAERSLHALKAVSCDSSTFLYEMSSIEEQLEDVSMCLEA
PATPEWDPTRAQELMVASAVLAATQQRYLLLLQASDALDQSSRQGENQSTKTEQRLQKTK
LQLEQTAERLAFQTPSSTNPTLEKIVRVIRDAFIWAKQTEFQIKTKRGKIALLPEDVHRQ
IRDLKKLQSEVMVKQGQLEVLLEEVTELFPQMDQEKEVPMVRSSLEDLNLLSMSTTQDLT
TAVREIESGLQNREKMSEQIADVEAWVVWYFLQKASRRGEEDVSVSGFDRQSRQIWETLA
DAEKQSAVCEALLMKSKDIFSELSVTENRFLHAKLTDLKEDITNITSYALTKKQDLESRV
QTQEASKQKVAALEKNLRQMLVDLNRHRFPVTRESLRTMEALKHMIVEHKSQVDQLHASI
PLGKRRELLSVNWELYGKMSKLDQKARDHECYLNLRQSMEDIQDNMEQEIFQTKEENRGV
GERYRMCNSLLARFPLVKAMSEDAGGKLQSISSDLYPSQLTVERQRLEQVVEKMDDWEVV
VRNNLIIVQWNVLKDLDLQTEWRSTHGLLDATLRQLRPVSEPKEAEMVKEQRRMLSMNKI
LEYKVKEYEILEQRKGNGQESRSRDLVTLKNTVLQECDSRMKNITSAKESLRSYTQGVQT
AVHFLLEAEASLLPVHDPAGDCSSGLQELQQTLVSLEQRYQDHVDQIQALVPSHPHLNSQ
KVEQLHREVLSGLLVRMTTFRAQALIRTQELTRCAEQSRRHVQQEEISECVNTQEDILSR
LLKVSSLSDCSQQQSQLKVTPLPIKINRLTLESLSEDVGATLGRLEALEDTCPEQGCRGD
REAAVAALWWQLSTLQQDALDLSTQAGRRAAEWSEISKSLEQSSSLLDEVEAEAPGGAPG
SASSEELQDQVQLWDQYQERLDWEHRALSALELRIARLLGVPAHLEQAPPTPLCQQVQAM
QGRYHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXE
ISRQLLTQKALLKSLMDSLKTKYSDTLPLELETQLQEVNHSIQEVEVKVGEAVERSGPLH
RLGSKLAEIRAGLGSVGERLEQRSPSVAEAERTQKRVWDELDVWHSCLAALEVELQYLEV
PEEALVLQERLSSVQEVHSQLAKQAEQRTGFLSKIPAWLQQHQEMIQSSRVWLLEAQTWL
TSPCSYTSAKCLFSHVHALKMVLEDSQHIRSSLQGLGGVLEGMAGVCDVTALRQQLDQAD
AXXXXXXXXXXXXXXXXXXXXXEVEAIEMEVRSMERNVSEIRALLSSPETPQPPRDSLKQ
VIEEKVQCMRTTVVEIQRCRPDLGLPEPLEATLAVFGVVDQLQTLLMELEKVXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRIAHLEQDVLTWS
GATLQSVQQASPDQRLVTGHAPSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXGPGAGSGPGPSSPRGHAVGERTRQLEDWLHGAQRSPAAMETNVKQQLLTCQEM
LQEIEQKVTSMSPQGGLVSAGSDQESAELLASKLELLKTNLVSFQHLLEGRREMFSSPKN
QLLRQSSVQQQKVRAGTGAEAEGTDPSHRATQQRTPPRPGPRGTKLAVATVTCCXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLSA
ELGSLSRELTSLGSKLTGVLGSASGQRCLDLLIRVLPAVQTGLRDRRNHLELLQQKSSQL
QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXGALDVAQAGVSSRREELQVGADLQRHYERLVLGLEELVTLGSQRLSLL
PGVELYTRDRLEGLLSSHTKFFQSLDGHVGSLQYLSGRVQDGAPGRRAEEVQALQDKVSQ
LRLQALEHGCKMEDTLQIWALWEQDSSWLDGLLSDTETSAPKMHLAQDSEEDVQKLSGAL
EDSRPRLGQLSEAGLWLQGAGCREVGVATKKQEARWNRLHKRLDHDRKLTERNRKLLNXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXVLQAAALQQQCFGGQCELWASFLQRMEDSLAVELPG
CYSGLREQLHTHTDTHVEVSIGHQTLHSVVSEALLLLQREEVDDRSDFLLQLSQLRAQWA
GAVGRASQRCSLVEGLVRHRHAYTRGLRKIQHFLSSLLLLHRSWRALQXXXXXXXXXXXX
XXXXXXXRVALLSQRYQSSYLQTLEVGRQLFSMGDEDTQAGLQAELGPLQEGWDRLHQQL
AKRTALTRSIIQSWELYETCLADSTLALKDVKTRLNQSMSEWPSERPGEEQFYEESQSML
GDWAESLSELSMMKTDLSQYIMADNVLLLQEQVAQLNSQWEDLCLQVSQRRQEIADRLNA
WVIFNEKNKELCDWLSQMENRVLDDSDISIEDMVEKLKKDCMEEINLFGENKGHLKQLGE
QLISASSQSRETEVHHKIQDVTDRWQHLFDHIETRVRKLKETLGTIQRLDKNMSGLRTWL
ARVEAELTRPVVYDHCHGDEIQKKLSEQQELQRDIEQHSAGVSSVLALCEVLLRDGDAGX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEETWRLWSKFLDDHARFEDWLRSAEVT
AASPQSADVLYTTAKEELKKFEAFQRQVHERLTQLELVNKQYRRLARENRTDASGRLKAL
VTEGNRRWDVLQRRVAAVLRRLKYFTSQREDFEGTREGLLVWLTEMDLQLTNVEHFSQSD
VEDKMRQLHVFQKEITLNTDRIDGLIVFGEQLIQKSAPLDAVLLEDELQELHSYCQEVFG
RVARFHQRLLNRRPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQAT
CHLLVPPLERSGRGTPASLDSIPLEWDHTVDVGGSSSHEDEEEATYFSALSVKSGSEAPS
WHQPSSPDITHPCLQQGYVRAKLMSECSGNIDSVKRVKLVLNDEEELEEAGLTCSTAEKX
XXXXVIERWELFQAQTLQAGVHQDLEQWKKLNSDLSDVTSWLGRMGPELEELQRLAPATS
LQDIERNIWKLKDMQRTLNRHKGAVISINLGSRHFQRGDSPEVRRLQEDLQEANQRWAGA
CAGLQAWETGLQGALMECQEFHETLHSLLLGLARVEGLLCVAPCVVQEELRGQQQQVSSL
QEISSQLLLEVTEEDGLEAKEKVHVIANKLRLLLRRVGGELGALRGRLPRPRQDASPPRS
FFHRVLRAALPLHLLLLLLMVLVCLVPLAEEPYSCTLANNFARSFYPMLRYTNGPPPT
Download sequence
Identical sequences ENSGMOP00000020283 ENSGMOP00000020283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]