SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020289 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020289
Domain Number 1 Region: 324-599
Classification Level Classification E-value
Superfamily Mitochondrial carrier 7.06e-79
Family Mitochondrial carrier 0.0000599
Further Details:      
 
Domain Number 2 Region: 6-152
Classification Level Classification E-value
Superfamily EF-hand 1.8e-21
Family Calmodulin-like 0.026
Further Details:      
 
Domain Number 3 Region: 153-286
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000237
Family Calmodulin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020289   Gene: ENSGMOG00000018887   Transcript: ENSGMOT00000020789
Sequence length 677
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3235:219592:227911:1 gene:ENSGMOG00000018887 transcript:ENSGMOT00000020789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQSTKRADPSELKAIFQKYASVADKDGEKLMTPGDFVQKYLGLHTQIHHNPKTVQLIAGV
ADTTKDGLISFQEFLAFESVLCVPDALFIVAFQLFDKTGTGDISFENVRDIFGQTTVHHH
IPFNWDCEFIRLHFGHDRKKRLSYLEFTQFLQELQLEHARQAFAQKDNGKSGAISAMDFS
DIMATIRHHMLTPFVEENLVSAAGGNTSHMVSFSYFNAFNSLLNNMELIRKIYSTLAGTR
KDTLVTKEEFVHAANRFGQVTPMEIDILYQLSGLHSASGRLNLADIERIAPLEEGSLPYH
LVEAQKQQAQGDTSRPVYLQAAESAYRFSLGAIAGATGATAVYPIDLVKTRMQNQRSTGS
FVGELMYKNSFDCAKKVLRYEGFFGFYRGLVPQLIGVAPEKAIKLTVNDFVRDKFTTKDG
SIPLFAEVMSGACAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALNVVRDLGFFGLYK
GAKACFLRDIPFSAIYFPVYAHVKAEFADEQGRLGALQLLTAGAIAGIPAASLVTPADVI
KTRLQVAARAGQTSYTGVIDCFRKIMQEEGFRALWKGAGARVCRSSPQFGVTLLTYELLQ
RWFYVDFGGHRPAGSEPTPKSRISELPPIHAEHVGGYRLAAATFAGVENKFGLHLPKFKS
SGVVSIHQAEPAKTPAP
Download sequence
Identical sequences ENSGMOP00000020289 ENSGMOP00000020289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]