SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020303 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020303
Domain Number 1 Region: 572-842
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-79
Family Protein kinases, catalytic subunit 0.0000206
Further Details:      
 
Domain Number 2 Region: 411-526
Classification Level Classification E-value
Superfamily PH domain-like 4.93e-32
Family Pleckstrin-homology domain (PH domain) 0.0000247
Further Details:      
 
Domain Number 3 Region: 253-315
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.43e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0016
Further Details:      
 
Domain Number 4 Region: 138-198
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000127
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020303   Gene: ENSGMOG00000018890   Transcript: ENSGMOT00000020803
Sequence length 884
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1441:315551:361504:1 gene:ENSGMOG00000018890 transcript:ENSGMOT00000020803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTSSPASLPRAYVHSLHPHHPSSPPGPLYSRLSNGSHSASSPTNSRGSFHGVSFLLQIG
LTRETVSLEVGDVSLSAVKDLVCSIVDQKFPECGFFGMYDKILLFRHDLSDENILQRLSA
AEDIXXXXXXXXXXXXLATVEDFQIRPHALYVHSYKAPTFCDYCGXXXXXXXXXXXXXXX
CGLNYHKRCAFKIPNNCTGVRKRRLSNVSLPGPSLSAPRPPPAETAVVVIEEQRSHQEAG
KRILSWSGRPIWMEKMVLGRVKVPHTFAVHTYTRPTICQYCKRLLKGLFRQGMQCKDCRF
NCHKRCASKVPRDCLGEVVFNGEPASPGPDSDNTMDTMEVDSSDTEGLRGLEDPEEPTTP
EDKMFFMDSPYLDREKDEEPVKIISPSTNTNIPLMRVVQSIKHTKRRSSTVVKEGWMVHC
SSRDNLRKRHYWRLDSKSLSLFQNDTGAKFYKEIPLSEILQVEPCRDYSQLAQGSNVHCF
EIITSTMVYYVGENHGGHYHSPTLAASGVGPEVAQGWEKAIRQALMPVTPQSSVASAAGH
GKDHNELSISISVSNCQVQENVDIASVYQIFSDEVLGSGQFGIVYGGKHRKSGRDVAIKV
IDKMRFPTKQESQLRNEVAILQNLHHPGIVNLECMFETPERVFVVMEKLHGDMLEMILSS
EKSKLPERTTKFLVTQILVALRHLHFKNIVHCDLKPENVLLASAEPFPQVKLCDFGFARI
IGEKSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIVYVSLSGTFPFNEDEDINDQI
QNAAFMYPPTPWKDISAEATDLINNLLQVKMRKRYSVDKSLSHPWLQDYQTWLDLREFET
RRGERYITHESDDARWEEYSDEHCLVYPKHFIMAPNLDDMDEDP
Download sequence
Identical sequences ENSGMOP00000020303 ENSGMOP00000020303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]