SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020351 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020351
Domain Number 1 Region: 21-256
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.92e-78
Family Calponin-homology domain, CH-domain 0.0000238
Further Details:      
 
Domain Number 2 Region: 513-633
Classification Level Classification E-value
Superfamily Spectrin repeat 6.67e-29
Family Spectrin repeat 0.00000183
Further Details:      
 
Domain Number 3 Region: 394-508
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-23
Family Spectrin repeat 0.00000129
Further Details:      
 
Domain Number 4 Region: 276-398
Classification Level Classification E-value
Superfamily Spectrin repeat 5.04e-22
Family Spectrin repeat 0.00000303
Further Details:      
 
Domain Number 5 Region: 741-867
Classification Level Classification E-value
Superfamily EF-hand 3.63e-19
Family EF-hand modules in multidomain proteins 0.009
Further Details:      
 
Domain Number 6 Region: 637-747
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-19
Family Spectrin repeat 0.00000258
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020351   Gene: ENSGMOG00000018933   Transcript: ENSGMOT00000020851
Sequence length 895
Comment pep:novel genescaffold:gadMor1:GeneScaffold_119:1185488:1208895:-1 gene:ENSGMOG00000018933 transcript:ENSGMOT00000020851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTQVETIVHYDNGYGYEEEYMLQEDEWDRDMLLDPAWEKQQRKTFTAWCNSHLRKAGTQ
IENIEEDFRNGXXXXXXXXXXXXERLPKPDRGKMRFHKIANVNKALEFITSKGVKLVSIG
AEEIVDGNVKMTLGMIWTIILRFAIQDINVEETSAKEGLLLWCQRKTAPYRNVNVQNFHV
SWKDGLAFCALIHRHRPDLLDYSKLNKDDPLGNLNLAFDIAEKHLDIPKMLDAEDIINTP
KPDERAIMTYMSCFYHAFAGAEQAETAANRICKVLGVNQENEKLMEEYERLASEXXXXXX
XXXXXXXXXXXXXXXXEMQRKLEDFRDYRRMHKPPKVQEKCQLEISFNTLQTKLRISNRP
AFMPSEGKMVSDIASAWQGLEQAEKGYEEWLLTEIRRLERLDHLAEKFRQKATTHETWAT
GKEQILSEKDYETASLTEIRALLRRHEGFESDLAAHQDRVEQIAAIAQELNELDYHDVAA
VNQRCQAICDLWDQLGTLTQKRREALERTEKLLDTIDQLFLEFAKRTAPFNNWMEGAMED
LQDMFIVHTIEEVQSLIAAHEQFKATLPEADGERQAIVGIQNEVQKISQSYSIKASDINP
YCTITMEDLMNKWDKIKKLVPGRDGSLQEEMARQHANERLRRQFAAQANLIGPWIQTRME
EVGRCSLEMGALEDQMTQLKQFEHIIVAYKPNIDKLEGDHQLIQESLVFDNKHTNYTMEH
IRVGWEQLLTTVARTINEIETQVLIRDAKGISQQQMNEFRSSFSHFDRKKNGAMETDDFR
ACLISMGYDLGEVEFARIMLLVDPNASGAVSFQSFIDFMTRETADTDTADQVVASFRILA
TDKPYILVEELRRELPPDQAEYCIMRMPPYKCPGAPPGALDYTAFSTALYGESDL
Download sequence
Identical sequences ENSGMOP00000020351 ENSGMOP00000020351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]