SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020466 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020466
Domain Number 1 Region: 1641-1739
Classification Level Classification E-value
Superfamily Plakin repeat 2.35e-17
Family Plakin repeat 0.01
Further Details:      
 
Domain Number 2 Region: 249-372
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000847
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 3 Region: 671-785,815-841
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000443
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 4 Region: 61-191
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000042
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 5 Region: 548-654
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000596
Family Spectrin repeat 0.016
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000020466
Domain Number - Region: 167-239
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0935
Family Spectrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020466   Gene: ENSGMOG00000019028   Transcript: ENSGMOT00000020967
Sequence length 1742
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1058:17792:33153:1 gene:ENSGMOG00000019028 transcript:ENSGMOT00000020967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APSTELAALIEKLQKNADKVEKNIYETEQNLNKDVSKINEGKQPLYQDDTNKRILNSLEL
LNGLDDDAVNTKRLQHPQAEMIDKDMKQLRERVMKLKEDHDHIYHLTRSDARPSINWGKI
IDEKTDNLANKGFGQDLPTVENEVEDHNILHSEVEALAPHISDNEDKEYVSGLQTKYNKL
LTNSSARQRHLLSLRDYMQRCTNELYWMDQQAEERINYDWSDTNLDYPARQRQYENFISK
CLESKEATITKLNDDGETLMASGHPGKNVIEAHMEAVHADWKEYLNLLICEENHLKHMDE
YHKYNKEARDTQDLLKRMETEINQKYSPDFKDMYQMDGLIRELDDQAKAMDHFDERVKAL
QKHSLQVLPLKYRRDAPQKQLPVEALCEFDADEGQIVRGERYNLLRNNGAKWDVKDAAGH
KITAPGVCFIIPPTDPEAVSISDGLNSQQNSIKQKMATSRGTLSKRLDELKLESGSGTDK
QEQQCRQLMAGLDKEISDLDKQEKAIYTRVRPPLEQTRPLQDSADRLQDMKDIAAAVSLI
EPEKRSKVQQAESFLASNPKCSSAPQLHTKVTDANNKYNKVELLLKCSEEKLKKSNQLEN
SLQNGKALLSTYENQLAREAVAPSDITSLEKTQRELADIGSELRAKRSVLAETELNLREA
KGSCNTMATKLQEHCPDIERQETEVQRLNKRFDNLQRQTDTRSQSLQRAKMAYNNYRNDY
DNLNMWLSRVPNYEPRETDDVGQVETKLKNQRNLLSDIARKESDLNNVSKNARLYQHAVT
DYENETEKFKSILDLEDGLVPQTYKRSRLDSPAKRVKSEESAIEAKFTEVNAINKQRQVN
LEFTQSLLNQLQQPDITMIQRKNVESIQSAPPGEESWRIRKLLNDEVQRREQLEKEIETI
QTDIYVLEGQKPQDTIVKREHIKKVPDPQLDEEVHKVQHRLSEERRTTRVLENDLEVFQL
KLRGLETEVKEGAQQYTVKEVLRIERDRGQEEEVRKLREEMEELRRQKMIKDNDLVEIQK
RVTILAEEKDKEQEVITEEEVIKVQNDPQLESEYRILLDRKQKETDGRTQLEDELRFLQE
KLRRLEKEKAMAEEKISIKEVVKVSKDPALEREVENLRRQYDDEKTRRRSSLREKTDLQR
KVTSLEEDNSKVIVQEKVREIIRPDPKAENEVASLRLDMVEQQRRYKDSEIHLRSLQDEL
TMLRNRGPQVEVKEIIKEVIKYKTDPQTEQELEKLRNEIVDKTHQTEKSEMEIRQLNEEI
QRWKDTKPQVQTKEVVNEVLQYREDPKTKEEIETLKRKLADEQTKRLDLERERSTQEDKI
RVRKIDLSQVREKIVQEEVVKMEEDPLLKAECNTFMQNINTEQRQKETLRDELLKLQRQK
ADLDLQLEELERERRSRREYELEIQRLRVKLSELEIRDKENREKVTVKQKVVLQADPQQE
KEHSMLRLQVEEERHKRTLLEKELNILIQKQLTLEKIDVKERVVRTEKVQVEKDPEAEYE
IENLKRALEDEKRRKRELDLELASINSKLSDMEFSNTKSSKDLDYIRNESGLLQQENLRL
QNEIRKLRSEIQITSKETRFITESAPTENGKNLELRVDSLQRELTDLRTVTGQKEDEIQK
LQKSLSAVRVKKEQRESHLRRSIVVIDPESGKEMRPEEAYRLGLIDWKMFVNLQGQECDW
EEISVKGPQGDSSVLHDRKSGQKFSIDDALRMGHITNRQLQQYLDKEITIQEFGIMVSGN
NK
Download sequence
Identical sequences ENSGMOP00000020466 ENSGMOP00000020466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]