SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020524 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020524
Domain Number 1 Region: 124-504
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.65e-117
Family Myotubularin-like phosphatases 0.000000486
Further Details:      
 
Domain Number 2 Region: 5-117
Classification Level Classification E-value
Superfamily PH domain-like 5.74e-19
Family GRAM domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020524   Gene: ENSGMOG00000019079   Transcript: ENSGMOT00000021026
Sequence length 530
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1441:908457:917104:1 gene:ENSGMOG00000019079 transcript:ENSGMOT00000021026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFSEHIRTANVENVVLRQPFHPSTKGTLCITGHHLIFSDRESQSCRQVLLLLRNIDAIE
KSRAPGPSSGTLTIKCKDLCVFQLDIPGMEQCLNIAHSIEALSSMNEVADMYPFFHRPHD
ASLQDQWGLSSPQHQYHQMEALRGRWRLSYVNGDHTVCPSYPPTVLVPKAISDEVLLKVA
RFRQAGRFPVVCYHHRKNGKVIMRSSQPLTGANRKRCQEDELLLQAVIDGSDKGYIIDTR
SSQQAQQARMTGGGVESKSSYPGWTRLHRQMEKGKSLQESLIKVVEACGDQTNNMDRWLS
KLENSKWLYHVQTALSTAGLLAECVERDGHSVLVHGSEGTDCTLLISTLAQLIMDPTCRT
LEGFLTLLEREWVQGHPFQQRCARSAHSHARLQQEAPVFLLLLDCAWQLWYQFPLALGFS
EDLLLRLATEAYASDYGTFLCNSDRERCAIGVKEKTHCLFQALLKPEERELYSNPLYEST
ELAIWPSVHPQSLQLWRGFFLRWSQQGRHLEEAHDEMRNMICQWGRLAVR
Download sequence
Identical sequences ENSGMOP00000020524 ENSGMOP00000020524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]