SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020548 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020548
Domain Number 1 Region: 2-89
Classification Level Classification E-value
Superfamily EF-hand 9.8e-26
Family S100 proteins 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020548   Gene: ENSGMOG00000019105   Transcript: ENSGMOT00000021050
Sequence length 97
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2324:353867:354265:-1 gene:ENSGMOG00000019105 transcript:ENSGMOT00000021050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMSELEKCMESLISVFHRYAAGDGDKATLTKKELKQLLEKEFSTFLSAQKSPDAVDKIMK
DLDQNNDKKVDFGEFMVFVVGLSTACKHFIGHQKKGK
Download sequence
Identical sequences ENSGMOP00000020548 ENSGMOP00000020548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]