SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020626 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020626
Domain Number 1 Region: 41-778
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.97e-248
Family Motor proteins 0.000000000387
Further Details:      
 
Domain Number 2 Region: 1885-2001
Classification Level Classification E-value
Superfamily Second domain of FERM 9.55e-18
Family Second domain of FERM 0.006
Further Details:      
 
Domain Number 3 Region: 1190-1293
Classification Level Classification E-value
Superfamily Ubiquitin-like 2e-17
Family Ras-binding domain, RBD 0.082
Further Details:      
 
Domain Number 4 Region: 2002-2092
Classification Level Classification E-value
Superfamily PH domain-like 6.85e-17
Family Third domain of FERM 0.025
Further Details:      
 
Domain Number 5 Region: 1785-1893
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000575
Family First domain of FERM 0.054
Further Details:      
 
Domain Number 6 Region: 1285-1378
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000454
Family Second domain of FERM 0.01
Further Details:      
 
Domain Number 7 Region: 783-847
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000412
Family Motor proteins 0.052
Further Details:      
 
Domain Number 8 Region: 1520-1575
Classification Level Classification E-value
Superfamily SH3-domain 0.00000779
Family SH3-domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020626   Gene: ENSGMOG00000019141   Transcript: ENSGMOT00000021131
Sequence length 2106
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2725:221067:258248:1 gene:ENSGMOG00000019141 transcript:ENSGMOT00000021131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGDYVWLDSGTGVPIGARVKESEKGKLQLVDDEQVHKVGTKEQAALRPMHPTSVEGVEDM
IRLGDLTEAGLLRNLLVRHKEGSIYTYTGSILVAVNPYKVLPIYTAEQVHMYTDRRLGEL
PPHVFAIADSCFFNMRRSQKNQCCVIRGESGAGKTESAKLMLQYLAAVSGQRSWIEQQIL
EANPILEAFGNAKTIRNDNSSRFGKYIDINFNTQGAIEGARIEQYLLEKSRVCRQAPEER
NYHIFYYMLVGMTPQQKTKLSLGNASDYNYLTMGKCTTCEGRDDITEYTHFLSALKILMF
SDSDSWEISRLLAAILHLGNVKFEGTSADNLEGCDIIESTHFNMAAKLMEVNGKALEKSL
TQRSFQTNRERVITSLNSEQAQDGRDAFVKAIYGRLFIWVVDKINSAVFKPLPEDSEEVH
QCIGLLDIFGFENFVKNRLSTTTTKPAVLLTLSHVFKLEQEEYSREGVVWTHIEYNDNQR
TLDVLASKPLNILALIDEESSFPKGTDRTMMQKVNKQHGKGDIYMAPKNDHEKQFGIRHF
AGVVFYDSQGFLEKNRDALSADVIELVETSTNQLLKQAFKTDLALGPDGKKRSPTLIGQF
RKSLEALMKALAACQPYFIRCIKPNDLKQPEFFDRDLCMRQLRYSGMMETIKIRKAGFPI
RYSFQEFLERFRVLLNTATCDPKTQESTDKCCETICKTFLSGEGHWRRGRSKIFLKDFHD
TMLELERMKKLNEKALVIQRVLRGLKYRKQFLRKKAAALMIQKHWRGHQGRKIYRVVQIG
LTRLQARVRSRQMQHKYQKKREAATVLQARVRGINARKEWRRQKAAVVLLQAYTRGALAR
RAVRKMKTDQGFLSAAERRAEELASLERQRRLNEALRRQREADAKAQDNPLSDHEMVDYM
FQFLPPAGGDQEGQGPDGFKMVPETVDLDELPMEEQELSSDEEDDLDEYSFSKFASMSFQ
GAATATHVRHRLAQPLIHHEDEGDVQASLTVWWIILRFMGDLPEPKQRVNPLAPGGAQGG
QPLPQDLASRNDRRLSNKKVGAIPENKVXXXXXXXXXXXXXXXXXXXXXXXNEMMAVDST
SLERPMTALEKLHIIVGYAIVRRDLRDEIYCQICKQLEGNNNKNSYYRGWILLSLCLGIF
PPTEKFIKYLQSFIRSGPGGYGPYCVERLKRTASNGVRGEPPSWLELQATKTKKRMTVTL
TLMDGRTISVPVDSASTSGEICQMLSQKVQLKDSFGFSVYVALYEKVWALGSGREHVMDA
ISQCEQEVRRKGGQEQHAPWRLYFRKEVFAPWHNCKDDAVSTELIYRQVIRGLKFGEYQC
RKEDDYVELTTKHLYIQHGRAGAAEQVKAAVQDAISSSLLEAKPEDKWIQMVNTAHTQKT
DVVEYARKNWPMFFSRFFEVVKVSGPALAKSRFIVAINWTGITFLDERERRLVELSYPEV
TGVNTVDLLPLISDPSFVLTRDPKSSAQSVCLLTLRGDFTLSGAMTEDLAALVLVFLAGL
RERSQYGVALKDASXXXDATLLSFKKGELLELLKDKEFSLERGWLKARNDRTGKSGAVPA
EALLILPTLSKPTNQVMNLLNLSPDQRKSAIQQTGTTEKVTLTSLKEFSIEYFRQPTKDV
NRQVMSKNAGPERLWVHSREPLRLPLLRRLANNADHSTKACLAFTSILKYMGDYPTKQSQ
SSLELTDQIFGAATQNEALRDEIYCQIMKQMTSNNNRFSLEQGWQLLWLCCGLFPPGPQL
SKHAQRFLESRERQPLAADCLKRLQSSRSRTDPRKLPPHQVEVEAIQQNSIQIFHKIHFP
NDTEDVMEVATSTRVRDLVQSISEKLGLISADGFSVFVKTPDTVLSLNEADYFFDSLRQI
TDWSKNAKRVNEGGPVSVSYMVFFMRKLWYNVIPGRDLEADLIFHYPQELPKYMRGYHVV
TKEEMVHIGALLFRIKTGGDSKQLAVLPKLLKEILPADQIKAFSENEWKKTISAAYNKQA
EMTSEEAMLEFLKAVYRWQTFGAAFFDVKQTSDRTFPDIVRIAISKTGVAIIHPKTKXXX
XXHAFNRIASWCSGSTYFHMTLGSLVQGSKFLCETSLGYKMDDLIGSYVNMYLREQKPAR
DQRFNM
Download sequence
Identical sequences ENSGMOP00000020626 ENSGMOP00000020626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]