SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020720 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020720
Domain Number 1 Region: 217-307
Classification Level Classification E-value
Superfamily PX domain 2.09e-25
Family PX domain 0.00066
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000020720
Domain Number - Region: 36-90
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0117
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020720   Gene: ENSGMOG00000019266   Transcript: ENSGMOT00000021227
Sequence length 374
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1998:10381:105967:1 gene:ENSGMOG00000019266 transcript:ENSGMOT00000021227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSPPTQAAPLSTILPTPGLPETMTLVELRQAIVALMNRKDELDELNTSLRSLLDGEME
HSAVQRQETDSLQRKLTELEERHAARVQALGSRENEVLKVQLKKYVGAVQMLKREGSQAN
DGXXXXXXXXXXXXTKSMEDIEELAASYERKLIEVAEMHGELIEFNERLYRSLMAKDHLI
IHMRQELIDLRGPVPGDLSQTSDDPSLSDFETSHRALINVWIPSVFLQGRSANAYHVYQV
YIRIHDNEWNVYRRYTEFRELHNHLRNKFPQVDTFSFPPKKALGNKDAKFVEERRKQLQG
YLRMVMNKLIQTLPEFTTRPTKETLLSLLPFCLDTPQTTDGGAKTVRSKPSSRFPRLGRS
RNQDARPEPQSGDL
Download sequence
Identical sequences ENSGMOP00000020720 ENSGMOP00000020720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]