SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020741 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020741
Domain Number 1 Region: 276-469
Classification Level Classification E-value
Superfamily PH domain-like 1.67e-33
Family Pleckstrin-homology domain (PH domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 107-223
Classification Level Classification E-value
Superfamily PH domain-like 5.54e-22
Family Pleckstrin-homology domain (PH domain) 0.0074
Further Details:      
 
Domain Number 3 Region: 2-119
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-21
Family DBL homology domain (DH-domain) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020741   Gene: ENSGMOG00000019286   Transcript: ENSGMOT00000021248
Sequence length 471
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1215:59753:80701:1 gene:ENSGMOG00000019286 transcript:ENSGMOT00000021248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGVFDAYISEYDRSMSLLEESNRNNPAFAAVVKKFETESQEGGEVPLRHQLLQVIVRVLQ
YRMLLTDYLNNLSPDSKEYEDTQAALVIVSEVADQASDSLKHGENLLRLVHIEYSVRGKR
DLLKAGRVFVKEGTLMKVSRKCRQPRHLFLMNDMMLYTYPQQDGKYRLKNTLSLSGMKVS
KPVLDQVLNCLRIEVSDITIILSASSVGEREDWFHTLSRAIADNAAGLCTFGGPCSEVXX
AREKLWMALGEAAPVLVPVSHVMMCMNCTSDFSLTLRRHHCNACGKVVCRSCSRNRYPLK
YLKDRVAKVCDHCYAELRKRGSVSGACGNASPHTQRVSRPLSAVFQSLQPPNLWRSRKSS
STLSQVSLGAEGSTMSGSLQRRKKSKRKWKRLWFLLKDKVLYTFTSPEDKVASESLPLQG
LTVKLPTRPEEGGGSSVFQLYHKKTLYYSFRAEDQNSAHRWVNAIEEATIL
Download sequence
Identical sequences ENSGMOP00000020741 ENSGMOP00000020741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]