SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020751 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020751
Domain Number 1 Region: 185-458
Classification Level Classification E-value
Superfamily Mitochondrial carrier 5.62e-79
Family Mitochondrial carrier 0.0000488
Further Details:      
 
Domain Number 2 Region: 61-175
Classification Level Classification E-value
Superfamily EF-hand 2.18e-17
Family Calmodulin-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020751   Gene: ENSGMOG00000019298   Transcript: ENSGMOT00000021258
Sequence length 468
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3045:89121:94678:1 gene:ENSGMOG00000019298 transcript:ENSGMOT00000021258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGLCLYVPIPYSDPIEVQYFESDRLPTELKSLFKLSVFLPSQELSKYQKWRKKPPGREE
SKSSQLDFEEFVHYLQDYEKDLKLVVKSLDKKHSGGIDASMLKQSLQDLGVHISQQHAQS
VLHSMDRNGTMTISWNEWSDYPVVPATENIPEIILYWKHSTIFDVGENLMVPDEFSLEER
LSGMWWRHLVAGGGAGIVSRTCTAPLDRLKVMMQVHGCRANNMCIMSGLTQMVREGGVRS
LWRGNGVNIIKIAPETALKFMAYEQIKRMIGSDNATLTIVDRFVAGSMAGVIAQSSIYPM
EMLKTRLALRRTGQFSGIVDCAWQIFRREGLGAFYRGYVPNVLGIIPYAGIDLAVYETLK
NRWLQEYGSNRSDPGVLVLLGCGTVSSTCGQLASYPLALVRTRMQAQATKEGSRQLSMTG
VFRHILQTEGPTGLYRGLGPNFLKVIPAVSISYVVYEHIKTSLGVTSR
Download sequence
Identical sequences ENSGMOP00000020751 ENSGMOP00000020751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]